Net News Express

 
       
   
 Kategorien:
Topthemen (7)
Aktuelle Themen (6)

Frei lassen für wichtige Themen (0)

Wirtschaft, Ökonomie, Finanzen, Finanz- und Wirtschaftskrise, Geldsystem, Währung, Banken (6)

Medien, Journalismus, Propaganda, Zensur, Netzpolitik, Internet, Computer, IT, Digitalisierung (5)

Konzerne, Unternehmen, Monopole, Organisationen, Vereine, Lobbyismus, Korruption (0)

Überwachung, Daten, Geheimdienste, Spionage, Macht & Kontrolle, Totalitarismus, Sicherheit (3)

Krieg, Kriegsverbrechen, Frieden, Terrorismus, Rüstung, Militär, NATO (11)

Katastrophen, Unglücksfälle (0)

Deutschland (5)

Europa, Brüssel, EU, Europäische Union (3)

International (6)

Politik, Verfassung, Grundgesetz, Menschenrechte, Parteien, Wahlen, Demokratie, Recht, Gesetz und Justiz (1)

Arbeit, Gewerkschaft, Rente, Soziales, Gesellschaft, Alltag, Bildung (4)

Umwelt, Ökologie, Verkehr, Tiere, Agrarpolitik/-wirtschaft, Klima, Energie, Atomkraft, Oel, Rohstoffe, Gentechnik, Konsum, Verbraucher (7)

Ansichtssache, Meinung, Kommentare, Diskussion, Debatte, Hintergrund, Verschiedenes (9)

Widerstand, Revolution, Unruhen, Protest, Demos, Streiks (0)

Wissenschaft, Technik, Technologie, Digitalisierung, Künstliche Intelligenz, Zukunft, Forschung, Weltraum, Astronomie (0)

Gesundheit, Gesundheitswesen, Gesundheitspolitik, Medizin, Ernährung (7)

Feuilleton: Kultur, Geschichte, Literatur, TV, Fernsehen, Film, Musik, Games (6)

Sport (7)

Kirchen, Religionen, Esoterik, Grenzwissenschaften und Übersinnliches (0)

Termine, Veranstaltungen, Aktionen, Petitionen, Alternative Projekte (0)

Satire, Humor, Kolumne, Glosse, Kurzgeschichten (0)
 Krieg, Kriegsverbrechen, Frieden, Terrorismus, Rüstung, Militär, NATO (31)
01.04.2021 06:50:46 [Der Überflieger]
Weltweit toben 21 Kriege
Es mag überraschen, aber auf unserem Planeten herrschen derzeit mehr Kriege, als in den Jahren zuvor. Besonders stark betroffen ist davon das Gebiet der Subsahara in Afrika. Die Anzahl der zugleich stattfindenden Konflikte geht in die Hunderte. Diese finden fast überall auf der Welt statt.

Auf unserem Planeten leiden wir nicht nur an der Corona-Pandemie, sondern im vergangenen Jahr sind auch Millionen von Menschen, Opfer von Konflikten geworden. Das Heidelberger Institut für Internationale Konfliktforschung (HIIK) hat festgestellt, dass die Zahl der Kriege auf de höchsten Wert seit 2014 gestiegen ist.

01.04.2021 13:35:55 [Junge Welt]
Krieg in Syrien: Kritik an Sanktionen
Bei der fünften von ihr veranstalteten »Geberkonferenz« in Brüssel für die »Unterstützung von Syrien und der Region« ist die EU mit ihrer Spendeneinwerbung gescheitert. Lediglich 5,3 Milliarden Euro an Hilfsgeldern wurden zugesagt, wie EU-Kommissar Janez Lenarcic am Dienstag abend im Anschluss an die Sitzung mitteilte. Angestrebt waren 8,5 Milliarden Euro. Für das laufende Jahr 2021 können von dem Geld 3,6 Milliarden Euro verwendet werden, der Rest ist für das Jahr 2022 und darüber hinaus gedacht. Zahlreiche Hilfsorganisationen äußerten sich enttäuscht darüber, dass die zugesagten Hilfsgelder weit unter der ausgegebenen Zielmarke blieben.
01.04.2021 17:07:08 [Antikrieg]
Die NATO ist ein schlechter Einfluss
Ricochet berichtete kürzlich über interne Regierungsdokumente bezüglich einer Diskussion über den Verkauf von Sensoren für bewaffnete Drohnen an die Türkei. Im letzten Frühjahr genehmigte die Trudeau-Regierung eine Ausnahmeregelung vom Waffenexportverbot in die Türkei, die es dem in Ontario ansässigen Unternehmen L3Harris Wescam erlaubte, seine Technologie zur thermischen Überwachung und zum Zielen von Laserraketen zu verkaufen. Diese wurde anschließend im tödlichen Konflikt zwischen Aserbaidschan und Armenien um Berg-Karabach eingesetzt.

Bei der Erteilung der Ausnahmegenehmigung zeigten sich die Regierungsvertreter besorgt über die Interessen des Unternehmens und die Beziehungen Kanadas zu einem NATO-Verbündeten.

01.04.2021 17:36:43 [IMI-Online]
Krieg ist Frieden
EU-Friedensfazilität als Anreizsystem für Militäreinsätze und Waffenlieferungen. Am 22. März 2021 beschloss die EU die Regelungen für eine Europäische Friedensfazilität – klingt ja eigentlich nicht schlecht, könnte man meinen. Bei näherer Betrachtung entpuppt sich die Bezeichnung allerdings als grob irreführend, geht es dabei doch darum, EU-Militäreinsätze und Waffenlieferungen an Drittstaaten künftig „besser“ als mit den bisherigen Instrumenten finanzieren zu können. Zu allem Überfluss wurde die mit über 5 Mrd. Euro ausgestattete Fazilität auch noch als Schattenhaushalt („haushaltsexternes Instrument“) in einer rechtlichen Grauzone außerhalb des EU-Haushaltes angesiedelt. Dies hat unter anderem den „Vorteil“, dass das Treiben des Finanzinstrumentes der Kontrolle durch das Europäische Parlament entzogen ist.
01.04.2021 18:42:27 [Der Freitag]
Afghanistan: Frieden ohne Besatzer
Wer geglaubt hatte, Antony Blinken würde bei seinem ersten Auftritt vor den NATO-Außenministern die Verbündeten dazu vergattern, in Afghanistan durchzuhalten, sah sich getäuscht. Stattdessen wählte er eine eher vorsichtige Rhetorik und verzichtete auf jede Kampfansage an die Taliban. Mit deren politischer Führung wie der Regierung in Kabul soll ausgelotet werden, ob und wie die USA über den 1. Mai hinaus militärisch präsent bleiben. Präsident Joe Biden ließ dazu in einem Interview mit ABC-News durchblicken, es werde sich bei einer Verschiebung um eine „nicht sehr lange“ Frist handeln.
02.04.2021 14:15:07 [Antikrieg]
Die "Defender-Europe" US-Armee trifft ein
Nicht alles in Europa ist durch den Anti-Covid-Lockdown gelähmt: in der Tat ist die jährliche Mammutübung der US-Armee, Defender-Europe, die bis Juni auf europäischem Territorium und darüber hinaus Zehntausende von Soldaten mit Tausenden von Panzern und anderem Gerät mobilisiert hat, in Gang gesetzt worden. Mit Defender-Europe 21 wird das durch Covid verkleinerte Programm 2020 nicht nur wieder aufgenommen, sondern erweitert.

Warum kommt der "Europa-Verteidiger" von der anderen Seite des Atlantiks? Die 30 NATO-Außenminister (Luigi Di Maio für Italien), die sich am 23. und 24. März in Brüssel versammelten, erklärten: "Russland untergräbt und destabilisiert mit seinem aggressiven Verhalten seine Nachbarn und versucht, sich in der Balkanregion einzumischen."

03.04.2021 09:23:36 [Junge Welt]
Großmanöver: Neuer Fokus, selbes Ziel
Im März hat es begonnen, und in diesem Monat wird es auch öffentlich wohl wieder in stärkerem Umfang wahrzunehmen sein: das Großmanöver »Defender Europe«, das die US-Streitkräfte seit 2020 jährlich gemeinsam mit ihren europäischen Verbündeten abhalten. Wie im vergangenen Jahr geht es darum, das westliche Bündnis auf einen etwaigen militärischen Konflikt mit Russland vorzubereiten. Wie im vergangenen Jahr wird dazu eine fünfstellige Zahl an US-Militärs über den Atlantik nach Europa verlegt, um hier auf Straßen, Schienen und Wasserwegen den Marsch in Richtung Osten zu proben. Die »Defender Europe«-Manöver gelten als größte in Europa seit dem Ende des Kalten Kriegs.
03.04.2021 15:34:13 [VoltaireNet]
Die US-Armee „Verteidiger“ Europas kommt an
Die US-Armee, die mit dem Mythos der US-Landungen in Europa während der beiden Weltkriege spielt, nimmt einen Teil Europas ein, indem sie sich als "Verteidiger" ausspielt. Nicht ganz Europa ist durch die Anti-Covid-Einschließungen gelähmt, denn die jährliche Großübung der US-Armee, Defender-Europe, hat sich bis Ende Juni in Bewegung gesetzt. Sie mobilisiert auf europäischem Territorium und darüber hinaus, Zehntausende Soldaten mit Tausenden Panzern und anderen Fahrzeugen. Defender-Europe 21 übernimmt nicht nur das Programm von 2020, das wegen des Covid geändert wurde, sondern verstärkt es.
03.04.2021 17:34:18 [KenFM]
Ostern 2021: Kriegs- statt Friedensmärsche
Das Jahr 2021 hat mit einer mächtigen Hypothek begonnen: Corona, ungelöste kriegerische Konflikte in Äthiopien, Aserbaidschan, der Westsahara und nicht zuletzt in der Ukraine, die vor Donezk und Lugansk ihr Militär verstärkt und die Häufigkeit der Beschießung der Gegenseite erhöht. Im Schwarzen Meer befinden sich derzeit 18 NATO-Kriegsschiffe, darunter der große Raketenkreuzer Ticonderoga. Auch die Wiederaufnahme des Baus von Northstream II heizt den Konflikt weiter an. Am Mittwoch, dem 17. März 2021, ging US-Präsident Joe Biden weiter als je ein Präsident vor ihm. In einem TV-Interview bejahte er die Frage, ob der russische Präsident Putin ein Killer sei und fügte noch hinzu „ein seelenloser“. Die russische Regierung beorderte daraufhin umgehend ihren Botschafter in Washington, Anatoli Antonow, nach Moskau zurück.
03.04.2021 18:58:30 [ISW - sozial ökologische Wirtschaftsforschung]
Frieden – Kein Thema mehr?
Die amerikanischen "Atomic Scientists" haben vor kurzem ihre „Weltuntergangsuhr“, die nach dem Jüngsten Tag benannte "Doomsday Clock", auf hundert Sekunden vor Mitternacht vorgestellt: der menschengemachte Weltuntergang rückt in greifbare Nähe. Die Gründung der Gruppe geht zurück auf den Abwurf der Atombomben auf Hiroshima und Nagasaki. Seither versucht sie die Gefahren abzuschätzen, die der Menschheit durch selbst gemachte Gefahren drohen. Dies sind in jüngster Zeit (immer noch): Atomwaffen, aber auch: Gas-Emissionen, Cyber-Angriffe, der Missbrauch genetischen Materials und künstliche Intelligenz. Das Zusammenwirken dieser einzelnen Faktoren ist nicht nur nicht auszuschließen: Es potenziert die Risiken, verkürzt Entscheidungsspielräume und Vorwarnzeiten, ja, es entzieht Entscheidungen über die Existenz der Menschheit zunehmend menschlicher Verantwortung.
03.04.2021 19:02:32 [Telepolis]
Jemen am Ende
Vor wenigen Tagen jährte sich die Beteiligung der von Saudi-Arabien geführten Militärallianz im Jemen zum sechsten Mal. Am 26. März 2015 begann die vom Königreich der Sauds geführte militärische Intervention, die auch unter dem zynischen Titel "Operation Decisive Storm" (also Operation "entschlossener Sturm") bekannt wurde.

Die Entschlossenheit, diesen Krieg so einfach zu gewinnen, dürfte der saudische Prinz Mohammad bin Salman (MBS), der federführend für die Militäroperation war und immer noch ist, mittlerweile verloren haben. Zumindest wirkt dies so, was auch mit der Verkündigung von US-Präsident Joe Biden einhergehen dürfte, an Saudi-Arabien keine Waffen mehr verkaufen zu wollen.

04.04.2021 06:59:15 [RT DE]
Kramp-Karrenbauer: Russland ist "für uns eine sehr greifbare Bedrohung"
Für Bundesverteidigungsministerin Annegret Kramp-Karrenbauer steht fest: Russland ist "für uns eine sehr greifbare Bedrohung, sowohl konventionell als auch atomar". Aber auch China sei "eine systemische und strategische Herausforderung" und stehe in einer "systemischen Auseinandersetzung" mit Deutschland. Das sagte die CDU-Politikerin in einem Interview mit dem Redaktionsnetzwerk Deutschland (RND). Ihre Schlussfolgerung lautet, dass die Bundeswehr deswegen fulminant aufgerüstet werden muss:

"Wenn wir sicher und in Wohlstand leben wollen, müssen wir in unsere Sicherheit investieren."

04.04.2021 11:42:12 [IMI-Online]
Mali: Bounti war ein Massaker
Untersuchungsbericht bestätigt Vorwürfe gegen Frankreich. Anfang Januar 2021: Nachdem kurz zuvor die erste weibliche Angehörige der französischen Operation Barkhane in Mali getötet worden und die Zahl der französischen Gefallenen dort auf insgesamt 50 gestiegen war, führt die französische Armee nahe dem Dorf Bounti im Osten Malis Luftschläge durch. Nach Angaben des französischen Verteidigungsministeriums wurden dabei etwa 30 Menschen „neutralisiert“, die zuvor zweifelsfrei als Angehörige einer terroristischen Gruppe (groupes armés terroristes, GAT) identifiziert worden waren. Später legte auch die französische Verteidigungsministerin dafür ihre Hand ins Feuer und setzte noch einen drauf: Wer anders lautende „Gerüchte“ verbreite, spiele den „Terroristen“ in die Hände.
04.04.2021 15:35:04 [ISW - sozial ökologische Wirtschaftsforschung]
Studie zu allen militärischen Drohnen in Deutschland
Laut der UN-Sonderberichterstatterin für außergerichtliche Hinrichtungen, Agnès Callamard, verfügen mindestens 102 Länder über militärisch genutzte Flugdrohnen. Dabei überwiegen Systeme zur Aufklärung und Überwachung. Derzeit gelten die USA, Israel, China und die Türkei als bewaffnete Drohnenmächte. Der Begriff meint Staaten, die Kampfdrohnen besitzen, herstellen, einsetzen und mit dem Prädikat „kampferprobt“ weltweit vermarkten. In vielen Fällen werden sie dabei im Krieg, im Bürgerkrieg oder unter dem Vorwand der Terrorismusbekämpfung völkerrechtswidrig genutzt.
05.04.2021 06:57:35 [Neues Deutschland]
Bundeswehr will ihr Image aufbessern
Der Einsatz von Soldaten in der Coronakrise soll die Akzeptanz für mehr Rüstung erhöhen. Die Coronakrise offenbart, wie kaputtgespart die Strukturen für zivile Katastrophenhilfe und das Gesundheitssystem sind. Ob bei Schnelltests in Alten- und Pflegeheimen, der Kontaktnachverfolgung in Gesundheitsämtern oder der Koordination der Impfstoffverteilung: Überall fehlt es an finanziellen Mitteln und Personal, um die Corona-Pandemie zu bekämpfen und die Gesundheit der Menschen sicherzustellen. Dass in der »zweiten Welle« der Pandemie die Nachfrage nach Bundeswehr-Amtshilfe rasant angestiegen ist, verdeutlicht das Problem.
05.04.2021 12:13:28 [Buchkomplizen]
Warum Saudi-Arabien die Huthis im Jemen nicht besiegt hat
Im März 2015 hatte Saudi-Arabien mit seiner Koalition an Alliierten und der Unterstützung durch die USA und Großbritannien die Operation Decisive Storm gestartet. Zwei Monate davor war Salman bin Abdulaziz Al Saud an die Macht gekommen, Anlass war nicht nur der Vormarsch der Huthis, verbunden mit Teilen der jemenitischen Armee und anderen Anhängern des früheren Präsidenten Ali Abdullah Saleh, sondern der sich abzeichnende Abschluss des Iran-Abkommens, der Iran das Ende der Sanktionen in Aussicht stellte, wodurch das Land wirtschaftlich, aber auch militärisch stärker werden würde. Am 21. April wurde der Sieg erklärt, der Krieg ging weiter und verursachte eine weiter anhaltende humanitäre Katastrophe.
05.04.2021 12:23:33 [WOZ - Die Wochenzeitung]
Rüstungsindustrie: Gut getarnt ist halb gewonnen
Die Schweizer Rüstungsexporte sind um ein Mehrfaches höher als bisher ausgewiesen. Das liegt auch an Generalausfuhrbewilligungen. Erstmals wird publik, welche Firmen davon profitieren. Wer sich gut verstecken möchte, wird von der Zuger Firma SSZ Camouflage Technology gerne beraten. «Eine effiziente Tarnung», heisst es auf deren Website, «verwischt die charakteristischen Konturen eines Objektes, damit es vor dem Hintergrund nicht mehr wahrgenommen werden kann.» Im Sortiment von SSZ gibt es entsprechend Tarnnetze und Tarnanzüge, neu angepriesen wird auch der «Sniper Suit»: Dieser Überwurf soll Scharfschützen und Aufklärungstruppen vor Wärmebildkameras schützen.
05.04.2021 14:24:28 [NachDenkSeiten]
Der US-alliierte Krieg gegen den Irak
Ein „gerechter Krieg“ feiert seinen 30. Geburtstag. Ein Masterplan für einen Krieg aus edlen und selbstlosen Gründen, die nicht nur für alte Militaristen gut sind. Es liegt nun 30 Jahre zurück, als US-alliierte Truppen in den Irak einmarschiert waren. Es lohnt sich, Bilanz zu ziehen. Denn heute lassen sich viel sicherer Versprechen, Propaganda und Wirklichkeiten auseinanderhalten. Und es gibt noch einen sehr aktuellen Anlass, auf diesen ‚Zweiten Golfkrieg‘ zurückzublicken. Damals taten jene, die dem „Realoflügel“ der GRÜNEN nahestanden, alles, um den Pazifismus über Bord zu werfen. Heute machen sich Teile der Partei DIE LINKE dieselben Gedanken. Wie kann man sich als Koalitionspartner anbieten und gleichzeitig ein wesentliches Erkennungszeichen der LINKEN, keinen Kriegseinsätzen zuzustimmen, aushebeln?
05.04.2021 17:25:35 [Sozialismus Aktuell]
Trotz Pandemie: Rüstungsausgaben in Rekordhöhe
ie Corona-Pandemie offenbart fahrlässiges staatliches Handeln zu Lasten der Bevölkerung. Während die Rüstungs- und Militärausgaben Deutschlands für 2020 gegenüber der NATO zuletzt auf rund 51,39 Mrd. € beziffert worden sind, waren im Bundeshaushalt für die Gesundheit zunächst nur 15 Mrd. vorgesehen.

Dabei ist aufgrund des Verlaufs der Covid-19-Pandemie offensichtlich, dass die Steuergelder im Gesundheitswesen dringender benötigt werden. Während die Menschen gebannt, aber auch überdrüssig – auf Corona-Statistiken, Impfpläne, Vorschriften für Beschränkungen – schauen, kämpfen die Propagandisten der Militarisierung offensiv dafür, das Ziel weiterer Aufrüstung keineswegs sozialen, gesundheitlichen oder ökologischen Notwendigkeiten zu opfern.

06.04.2021 07:10:31 [Ossietzky]
Auslandseinsätze akzeptabel?
Die Debatte um eine Sinnhaftigkeit von Bundeswehr-Auslandseinsätzen unter einem UN-Mandat ist innerhalb der Partei Die LINKE nicht neu. Bereits Mitte der 1990er Jahre plädierte Gregor Gysi vehement für diese Option. In den letzten Monaten und Wochen ist dieses zur Gretchenfrage innerhalb der Partei mutiert: Wie hältst du es mit den Auslandseinsätzen? Unreflektiert klingen Einsätze unter UN-Mandat plausibel. Warum sollten sich hierbei einzelne Mitgliedsländer, zumal ein wirtschaftlich und politisch starkes Land wie Deutschland solchen kollektiven Verpflichtungen entziehen? Teilweise erinnert die medial stark kommentierte Debatte auch an frühere Kontroversen zwischen »Realos« und »Fundis« in der Partei Die Grünen.
06.04.2021 13:09:47 [Der Freitag]
Frankreich: Träumen von Jerewan
Der Krieg um Bergkarabach bewegt auch die Menschen im armenischen Viertel von Marseille. Nun, da Armenien den zweiten Karabach-Krieg verloren hat, muss ich noch einmal nach Marseille. Das letzte Mal, vor reichlich einem Jahr, entdeckte ich hier die größte armenische Community Westeuropas, bis zu 50.000 Marseiller sollen armenische Wurzeln haben. Ich geriet in Euphorie: Ich träumte mich in der ranzigen Bar „Cilicie“ ins mittelalterlich-mediterrane Armenier-Reich Kilikien hinüber, sah mich schon im Beiruter Armenier-Viertel Bourj Hammoud Macchiato schlürfen und buchte Billigflüge nach Beirut und Jerewan. Dann Corona, diese Flüge wurden sämtlich gestrichen.
06.04.2021 13:12:16 [NachDenkSeiten]
„Lockdown für das Militär!“
In seiner Rede auf verschiedenen Ostermärschen hat sich Reiner Braun gegen die aktuelle Meinungsmache gewandt: Mit der Behauptung, Hoch- und Atomrüstung, militärische Interventionen und Abschreckung würden „Sicherheit“ bringen, werde für Militarisierung geworben. Die Kräfte des Friedens haben es demnach mit einem starken Gegner zu tun, der in die Richtung eines großen Krieges drängt. Liebe Friedensfreunde,

dass wir heute hier stehen und für Frieden und Abrüstung demonstrieren, haben wir uns erkämpft, gegen eine Bundesregierung, die demokratische Grundrechte zunehmend als Privileg und nicht als historisch erkämpftes Recht der Menschen ansieht.

06.04.2021 18:59:22 [SoZ - Sozialistische Zeitung]
Rüstungsexporte: Die Kontrollen greifen zu kurz
Die Bundesregierung plant eine deutliche Ausweitung des Haushalts für Rüstung, Waffen und Kriegsbeteiligungen – eine heftige Steigerung während der Corona-Krise, wo dringende Bedürfnisse des Gesundheitssystems zu kurz kommen.

Begründet wird dies entweder mit Nachrüstungsprojekten, Preissteigerungen bei Anschaffungen oder mit der 2-Prozent-Regel der NATO. «Eine angemessene Ausstattung der Streitkräfte bedarf einer Steigerung der Rüstungsinvestitionen und höherer Ausgaben für die Modernisierung», heißt es auf der Homepage der Bundeswehr. 46,9 Mrd Euro sind eine Steigerung um 1,3 Milliarden oder fast 3 Prozent.

07.04.2021 17:24:00 [WSWS]
Kramp-Karrenbauer droht Russland und China
In einem Interview mit dem Redaktionsnetzwerk Deutschland (RND) hat Verteidigungsministerin Annegret Kramp-Karrenbauer eine weitere Erhöhung der Verteidigungsausgaben und eine massive Aufrüstung der Bundeswehr in den nächsten Jahren angekündigt. Sie droht Russland und China und unterstreicht den Anspruch des deutschen Imperialismus, seine wirtschaftlichen und geostrategischen Interessen weltweit mit militärischen Mitteln durchzusetzen – auch unabhängig von den USA und gegen sie.

„Eines vorweg, es geht um unsere eigene Sicherheit und um unser eigenes Interesse. Es ging doch nie darum, den USA einen Gefallen zu tun. Wir müssen für unsere eigene Sicherheit sorgen,“ betont sie gleich zu Beginn des Interviews.

07.04.2021 18:39:32 [IPG - Internationale Politik und Gesellschaft]
Globaler Rüstungsboom
Vor einem Jahr, zu Beginn der Pandemie, rief UN-Generalsekretär Antonio Guterres zu einem weltweiten Waffenstillstand auf. Es ist jetzt an der Zeit, einen gemeinsamen neuen Vorstoß für Frieden und Versöhnung zu unternehmen. Guterres plädierte für verstärkte internationale Anstrengungen, vor allem im Sicherheitsrat, um bis Ende des Jahres 2020 einen globalen Waffenstillstand zu erreichen.

Die Welt braucht einen globalen Waffenstillstand, um die „heißen Konflikte“ zu beenden, und wir müssen alles tun, um einen neuen Kalten Krieg zu vermeiden. Doch sein dringender Appell blieb und bleibt weiterhin ungehört.

08.04.2021 11:12:56 [Heise]
Drohnengefahr im Schwarm
Experten warnen vor den militärischen Fähigkeiten von Schwärmen aus kleinen unbemannten Fluggeräten. Drohnenschwärme könnten schon bald zu Massenvernichtungswaffen werden warnt der Sicherheits-Spezialist Zachary Kallenborn im Bulletin of the Atomic Scientists. Folglich müssten sie international reguliert werden.

Die Zeitschrift, die von ehemaligen Mitarbeitern des Manhattan Project gegründet wurde, warnt seit 1945 vor den Gefahren eines technologischen Rüstungswettlaufs - und ist vor allem bekannt durch die plakative Darstellung des Atomkriegsrisikos auf ihrer Weltuntergangsuhr.

08.04.2021 17:13:36 [VoltaireNet]
Joe Biden rekrutiert Verbündete
Die Neuordnung der Armeen des "Amerikanischen Imperiums" hat begonnen. Bereits jetzt wurden französische und polnische Verbündete befördert, um US-Streitkräfte zu befehligen. In Wirklichkeit werden sie selbst unter US-Kommando gestellt und nur einfache US-amerikanische Unterstützungskräfte sein. Joe Biden kündigte dies in seinem Wahlprogramm an: "Während Präsident Trump die Verbündeten und Partner im Stich ließ und die amerikanische Führung abgab, würde ich als Präsident sofort Fortschritte machen, um die Bündnisse der Vereinigten Staaten zu erneuern, damit Amerika wieder einmal die Welt leiten würde".
09.04.2021 06:47:59 [RT DE]
Weißhelm-Chef gibt Terror-Verbindung zu
Selbst dann, wenn ein hochrangiger Weißhelm zugibt, dass einige der "Zivilschützer" in Syrien aus den Reihen der Terrormilizen kamen, erntet er ohne Nachfragen von kanadischen Staatssendern Lob und Besorgnis über "russische Desinformation". Am 30. März interviewte Carol Off, die Moderatorin der Sendung As it Happens auf Kanadas regierungsfinanziertem Sender CBC, Farouq Habib aus Montreal. Das Gespräch mit dem stellvertretenden Geschäftsführer der Weißhelme drehte sich um die Mitarbeiter der Organisation und deren Familienmitglieder, die vor fast drei Jahren nach Jordanien evakuiert worden waren (und zwar über Israel, mit Kanadas Hilfe).
09.04.2021 18:53:10 [Linke Zeitung]
Warum will die Ukraine Krieg?
Die ganze Welt beobachtet mit angehaltenem Atem, um zu sehen, ob es Krieg zwischen der Ukraine und Russland wegen Donbass gehen wird. Wie viele befürchten könnte ein solcher, aufgrund der jüngsten Ereignisse bevorstehen. Ich fragte Anfang dieser Woche, ob die Frage der „Impfstoffe die wirklich treibende Kraft hinter der jüngsten Donbass Destabilisierung“ ist, unter Hinweis auf das große strategische Interesse, dass die USA in der Provokation einer Krise haben, die beispiellosen politischen Druck auf die EU ausüben würde, Russlands Sputnik V nicht zu kaufen, wie das Top-Mitglieder des Westens Berichten zufolge im Moment in Betracht ziehen.
10.04.2021 13:20:56 [WSWS]
Bundeswehr rekrutiert für den Einsatz im Inneren
Am 6. April gab das Verteidigungsministerium den Startschuss für den sogenannten „Freiwilligen Wehrdienst im Heimatschutz“.

Verteidigungsministerin Annegret Kramp-Karrenbauer (CDU), der Staatssekretär im Verteidigungsministerium, Peter Tauber, und der stellvertretende Generalinspekteur der Bundeswehr, Markus Laubenthal stellten das Projekt auf der Bundespressekonferenz vor. Es sieht zunächst „für insgesamt rund 1000 Soldaten eine dreimonatige militärische Grund- und eine sich anschließende viermonatige Spezialausbildung vor“. Darauf folge dann eine „sechsjährige Grundbeorderung als Reservedienstleistende bei der Bundeswehr, in der mindestens fünf Monate Dienst geleistet werden sollen“.

11.04.2021 09:47:55 [Tichys Einblick]
Die Bundeswehr ohne brauchbare Flugabwehr
Dass die Bundeswehr nicht einmal mehr bedingt abwehrbereit ist, hat sich inzwischen herumgesprochen. Nun hat auch Verteidigungsministerin Annegret Kramp-Karrenbauer (CDU) eingeräumt, was für Fachleute schon lange auf der Hand lag: Es bestehe „eine akute Fähigkeitslücke“ bei der Flugabwehr. Anstoß für diese Erkenntnis ist der wenige Wochen dauernde Krieg im letzten Herbst zwischen Armenien und Aserbaidschan um die Enklave Bergkarabach. Aserbaidschanische Drohnen israelischer und türkischer Herkunft gaben den Ausschlag: Damit wurden reihenweise Flugabwehrsysteme, Kommandostände, gepanzerte Kampffahrzeuge und Artilleriestellungen zerstört.
 Arbeit, Gewerkschaft, Rente, Soziales, Gesellschaft, Alltag, Bildung (53)
01.04.2021 06:56:03 [Riff-Reporter]
Pflegeroboter – Wenn Maschinen Senioren umsorgen
Stellen wir uns einmal vor, Pflegeroboter ziehen bei alten Menschen ein. Sie werden zu ihren Helfern im Alltag, zu Ansprechpartnern, Gefährten. Angehörige sind beruhigt, und Pflegekräfte haben wieder mehr Zeit für Zuwendung. Wirklich? Manchmal ist Carlee wirklich ein bisschen doof. Heute Vormittag wollte sie mich zur Gymnastik überreden. Ich sollte mich auf Zehenspitzen stellen und Achten gehen. Dabei waren meine Gelenke mal wieder dick geschwollen, jeder Schritt tat weh. Das fand ich ziemlich unsensibel, und habe entsprechend unwirsch reagiert. Ist schon komisch, wenn man mit seinem Roboter schimpft, aber ich musste das einfach loswerden.
01.04.2021 07:06:00 [Neue Debatte]
Die große Scheidung des Jahrhunderts
Die Covid-19-Pandemie hat die tiefe Beziehung zwischen Arbeit und Geld in eine bittere Scheidung geführt. Millionen verloren ihre Arbeit und ihr Geld, manche behielten ihre Arbeit und ihr Geld und andere vermehrten ihr Geld, ohne viel dafür zu tun. Dieser Umstand begann nicht mit der Pandemie, aber er wurde deutlicher und kreierte eine soziale Misere mit stundenlangen Schlangen vor Lebensmitteltafeln. Wer in einem Restaurant, einer kulturellen Institution, einem Klub oder einem Theater arbeitete, den hat das Glück verlassen, war ohne Arbeit und ohne Einkommen. Wer einen Beruf ausübte, der die Arbeit aus der Ferne zuließ, konnte seine Arbeit behalten und es kam weiter Geld rein.
01.04.2021 13:44:54 [Aktuelle Sozialpolitik]
Erneut eine Ausnahmeregelung für die Erntehelfer
Die Erntehelfer aus dem Osten und was das mit einer Modernisierung der Betriebsräte (nicht) zu tun hat. Natürlich hat das eine – die „Modernisierung“ der Betriebsräte – nichts mit dem anderen – die Sonderregelungen die Erntehelfer betreffend – zu tun. Außer dass beide Huckepack durchs Kabinett gehievt wurden. Wenn man allerdings etwas über den Tellerrand hinausblickt, dann kann man schon einen Zusammenhang erkennen, denn ein strukturelles und großes Problem im Bereich der Erntehelfer ist natürlich darin zu sehen, dass hier die normalen Schutzfunktionen der Gewerkschaften und der betrieblichen Mitbestimmung nicht greifen, denn Betriebsräte gibt es hier nicht.
02.04.2021 07:23:59 [Gegenblende]
Hätte, hätte, Lieferkette
Das Lieferkettengesetz ist ein Fortschritt, doch es reicht nicht. Die Mehrheit der Unternehmen, vor allem in der berüchtigten Textilbranche, betrifft es gar nicht. Umso wichtiger ist es, das Investitionsabkommen der EU mit China zu verschärfen. Nur wenn dort freie Gewerkschaften ermöglicht werden, bessern sich auch die Arbeitsbedingungen. Die IG Metall übernahm in den späten 1990er-Jahren zwei kleine Gewerkschaften und war nun für Möbel, Mieder und Metall zuständig. Dabei lernten die IG-Metall-Beschäftigten neue Wörter kennen wie Erdmöbel-Industrie oder Logistikkonzern. Die Erdmöbel-Industrie fertigt Särge plus Zubehör. Ein Logistikkonzern besteht nur aus Einkauf, Vertrieb, Design und Marketing.
02.04.2021 12:07:33 [Junge Welt]
Betriebliche Mitbestimmung: »Verbesserungen wurden teuer erkauft«
»Betriebsrätemodernisierungsgesetz« vereinbart. Grundsätzliche Neufassung betrieblicher Mitbestimmungsrechte gefordert. Gespräch mit Jutta Krellmann: Betriebliche Mitbestimmung – für zahlreiche Beschäftigte in Unternehmen ist das längst keine Selbstverständlichkeit mehr. In wie vielen Firmen hierzulande gibt es überhaupt noch gewählte Betriebsräte?

Gerade einmal neun Prozent der Unternehmen haben einen Betriebsrat. Noch nicht einmal die Hälfte der Beschäftigten wird durch einen Betriebsrat vertreten. Wir erleben eine Erosion der betrieblichen Mitbestimmung in Deutschland. Immer mehr Arbeitgeber versuchen, aktiv Betriebsräte zu verhindern.

02.04.2021 12:19:24 [Heise]
Betriebsräte sollen über KI-Einsatz und Homeoffice mitbestimmen dürfen
Die Bundesregierung reagiert auf den zunehmenden Einsatz von Systemen für Künstliche Intelligenz (KI) in der Arbeitswelt. Sie will klarstellen, dass die Rechte des Betriebsrats bei der Gestaltung der Arbeitsumgebung und von Abläufen im Unternehmen auch dann greifen, wenn dort algorithmische Entscheidungssysteme eingesetzt werden sollen. Dies geht aus dem Entwurf für ein Betriebsrätemodernisierungsgesetz hervor, den das Bundeskabinett am Mittwoch auf den Weg gebracht hat. Betriebsräte müssen laut der Initiative in der Lage sein, "komplexe informationstechnische Zusammenhänge zu verstehen, zu bewerten und mitzugestalten und dabei zugleich allgemeine Belange, wie die Gleichstellung von Frauen und Männern, zu berücksichtigen".
02.04.2021 14:46:54 [Der Freitag]
Amazon: Ein historischer Streik
Interview: 40.000 Amazon-Beschäftigte legten in Italien die Arbeit nieder. Was deutsche Gewerkschaften daraus lernen können, erklärt der Soziologe Francesco Massimo. Der Freitag: Am 22. März legten in Italien nach Gewerkschaftsschätzungen 40.000 Amazon-Beschäftigte die Arbeit nieder. Streiks beim Internetriesen sind zumindest in vielen europäischen Ländern seit ein paar Jahren nichts Außergewöhnliches mehr. Sie sagen, der Arbeitskampf war historisch. Warum?

Francesco Massimo: Weil es der bisher erste Streik weltweit war, der große Teile des Vertriebsnetzes von Amazon umfasst: Von den großen Lagerhäusern bis zu den Lieferanten, die die Pakete an die Haustür bringen. Das ist historisch.

02.04.2021 14:53:49 [Aktuelle Sozialpolitik]
Die hochschulische Pflegeausbildung bricht ein
»Es gibt bereits Hinweise darauf, dass hierzulande im vergangenen Jahr Tausende Pflegekräfte in Krankenhäusern und der Altenpflege aufgehört haben. Ich weiß aus Gespräche mit Pflegenden, dass sie nach über einem Jahr Dauerstress in der Pandemie tatsächlich körperlich und seelisch erschöpft sind. Ich höre oft: „Ich kann nicht mehr. Ich halte das bis zur Rente nicht mehr durch. Ich schaue mich nach Alternativen um.“ Viele haben das Vertrauen in die Politik verloren, dass sich die Situation grundlegend ändert. Wenn wir nicht schnell das Ruder herumreißen, riskieren wir tatsächlich einen massenhaften Ausstieg aus dem Beruf.« Das sagt Andreas Westerfellhaus. Er ist ausgebildeter Krankenpfleger und hat zunächst auf einer Intensivstation gearbeitet.
02.04.2021 16:28:16 [Heise]
Berufsschullehrkräfte: Aus der Industrie an die Tafel
Die Zahl ist alarmierend: Bis zum Jahr 2030 geht etwa die Hälfte der rund 125.000 Berufsschullehrkräfte in Deutschland in den Ruhestand. Bis dahin werden also gut 60.000 Lehrkräfte gebraucht, um den theoretischen Teil der Ausbildung für etwa 2,5 Millionen Schüler aufrechtzuerhalten. Allerdings mangelt es massiv am Lehrkräftenachwuchs an den Berufsschulen. Laut einer Studie der Bertelsmann-Stiftung ist die hohe Zahl an Ruheständlern der eine Grund für den starken Bedarf, steigende Schülerzahlen der andere. Ein Teil des Problems ist aber auch: Schon seit Jahren schaffen es die Berufsschulen nicht, ihren Bedarf mit ausgebildeten Lehrkräften zu decken.
02.04.2021 16:45:39 [IPG - Internationale Politik und Gesellschaft]
Eiserner Vorhang der Löhne
Der Systemwechsel Mittelosteuropas nach 1989 wurde nicht nur von dem Wunsch nach einem Ende politischer Repression und mehr demokratischer Beteiligung vorangetrieben, sondern auch – und möglicherweise sogar vor allem – von der Hoffnung auf eine schnelle Angleichung der Lebensverhältnisse mit dem Westen. Man hat dafür zunächst dramatische wirtschaftliche und soziale Umbrüche in Kauf genommen sowie später weitreichende fiskalische, rechtliche und ideelle Vorgaben als Bedingung für die EU-Aufnahme ohne Murren akzeptiert und rasch umgesetzt, wenngleich dies mit nicht zu unterschätzenden Mühen und Kosten verbunden war.
03.04.2021 06:35:32 [Gewerkschaftsforum]
Die Grenzen gewerkschaftlichen whistleblowings
Gewerkschaftliche Whistleblower agieren in der Regel in einem Graubereich. Zwar kann es im öffentlichen Interesse sein, interne Informationen an die Öffentlichkeit zu bringen, jedoch ist der Schutz von Whistleblowern gesetzlich nicht klar geregelt.

Wenn Gewerkschaftsaktivisten die alltäglichen Widersprüche wie ständige Überlastung und ständigen Personalmangel nicht mehr aushalten und auf die Missstände aufmerksam machen, werden sie nicht nur mit dem Arbeitsplatzverlust bedroht.

03.04.2021 09:10:36 [ScienceFiles]
Uni-Kassel: Soziales Punktesystem soll Bewertungen ersetzen
Derzeit ist die Universität Kassel deshalb ins Gerede gekommen, weil offenkundig nicht Leistung, sondern ideologische Anpassung Grundlage der dortigen Bewertungen ist. Wie wir vor kurzem berichtet haben, ist es an der Universität Kassel möglich, schlechtere Noten dann zu vergeben, wenn sich ein Student nicht an die Vorgaben an das, was angeblich eine geschlechtergerechte Sprache sein soll, hält. Wenn Studenten also in korrekter Weise von Studenten und nicht von Student_:*Innen schreiben, können sie schlechter bewertet werden.

Dieser erste Probelauf in sozialer Unterwürfigkeit ist jedoch erst der Anfang.

03.04.2021 18:42:39 [Gegen Hartz]
Geschäft mit der Armut? Hausdurchsuchung bei der Tafel
Die Tafeln in Deutschland schließen die Armutslücke in der Lebensmittelversorgung, weil die Hartz IV-Regelsätze und Renten nicht ausreichen, um sich ausreichend zu ernähren. In Wuppertal haben Polizei und Staatsanwaltschaft die Räume der Tafel sowie die Wohnung eines leitenden Tafel-Angestellten durchsucht. Der Veracht: Untreue und Betrug. Das Angebot in den Tafeln ist eher spärlich. Zumeist werden Waren, die die Supermärkte nicht mehr verkaufen können, an die Tafeln für Bedürftige verschenkt. In Wupertal haben am gestrigen Tag Polizei und Staatsanwaltschaft bei der Wuppertaler Tafel “Am Kleinen Werth” und an der Privatadresse eines Angestellten an der Talstraße eine Hausdurchsuchung unternommen.
04.04.2021 07:05:52 [Deliberation Daily]
Präsenzunterricht wird überschätzt – von den Chancen des Fernunterrichts
Zu den beständigsten Streitpunkten rund um den Lockdown gehört die Klage, dass die Schulen geschlossen werden und unübersehbarer Schaden an den Kindern angerichtet wird. Nicht nur würden sie der Früchte ihrer Bildungsarbeit beraubt, sondern ihre Lernzeit sinke quasi auf den Nullpunkt. Riesige Wissenslücken täten sich auf, die nie wieder aufgeholt werden könnten. Die Abschlussprüfungen seien gefährdet, und ohne den 45-Minuten-Takt eines Schulvormittags werde quasi irreperabler Schaden an den jungen Gehirnen angerichtet. Selbstverständlich erfordert funktionierender Fernunterricht zuerst eine Infrastruktur.
04.04.2021 13:12:33 [Gewerkschaftsforum]
Tausende Pflegekräfte steigen aus dem Beruf aus
Etwas Besseres als eine Anstellung im Krankenhaus findest du überall und wenn es die Leiharbeit ist. Die Westdeutsche Allgemeine Zeitung (WAZ) berichtet Anfang März 2021, ihr liegen bisher unveröffentliche Zahlen der Bundesagentur für Arbeit (BA) vor, nach denen Deutschland in der Pandemie Tausende Pflegekräfte verloren hat. Allein zwischen Anfang April und Ende Juli 2020 ging die Zahl der Pflegebeschäftigten um mehr als 9.000 zurück. Der Rückgang betrifft die Krankenhäuser ebenso wie die Einrichtungen der Altenpflege. Eine Umfrage des Deutschen Berufsverbands für Pflegeberufe unter knapp 3.600 Beschäftigten von Ende des Jahres 2020 ergab, dass gut ein Drittel der Pflegekräfte darüber nachdenkt, ihren Beruf den Rücken zu kehren.
04.04.2021 17:10:23 [SoZ - Sozialistische Zeitung]
Corona in der Arbeitswelt der Provinz – ein Bericht
In der Diskussion um Corona wird das Risiko, sich am Arbeitsplatz anzustecken, fast völlig ausgeblendet. Die Ausbrüche in der Fleischindustrie, in Alten- und Pflegeheimen lassen sich nicht totschweigen, ebensowenig die Bedingungen in den Logistikzentren von Amazon.

Weniger be­kannt ist, dass die AOK Erzie­her­innen für eine hoch gefährdete Berufsgruppe hält. Die Be­schäf­tigten in den vom sog. «Lockdown» betroffenen Bereichen sind sowieso daran gehindert zu arbeiten. Völlig ausgeblendet aber wird die Situation in Industrie und Handwerk.
Der nachfolgende Bericht aus ei­nem Automobilzulieferbetrieb zeigt, dass dies fahrlässig und falsch ist.

04.04.2021 17:20:05 [Versicherungsbote]
Mittelständler der Union wollen Deutsche später in Rente schicken
Ein Thema ist in der Coronakrise ein wenig untergegangen: Die Frage, wie die gesetzliche Rente auch über das Jahr 2025 hinaus zukunftsfest gemacht werden kann. Bis zu diesem Jahr gilt, gesetzlich festgelegt, die sogenannte doppelte Haltelinie: demnach darf der Beitrag nicht über 20 Prozent vom Bruttolohn steigen und das Rentenniveau nicht unter 48 Prozent sinken. Doch wie geht es danach weiter? Im März 2020 präsentierte eine von der Bundesregierung eingesetzte Rentenkommission ihre Ergebnisse, sie sollte Antworten auf die Fragen finden. Die Ergebnisse wiesen viele Experten als ungenügend zurück: die Kommission war zerstritten, man konnte sich kaum auf gemeinsame Konzepte einigen.
04.04.2021 17:23:24 [Junge Welt]
Arbeitsunrecht: Pikantes Privatleben
IKEA ließ in Frankreich systematisch Angestellte ausspionieren. Staatsanwältin fordert »exemplarische« Strafe. Konzern sucht Sündenbock. Die Staatsanwaltschaft von Paris hat im Prozess gegen das weltgrößte Möbelhaus IKEA drei Jahre Gefängnis – zwei davon auf Bewährung – für den ehemaligen Frankreich-Chef Jean-Louis Baillot beantragt. Der Konzern selbst soll für das Ausspionieren von mindestens 400 Beschäftigten in den Jahren 2009 bis 2012 mit läppischen zwei Millionen Euro Geldbuße davonkommen. Staatsanwältin Paméla Tabardel sprach am Dienstag laut AFP von einer Haftstrafe für Baillot, »die sein Leben markieren muss«.
05.04.2021 06:44:24 [A&W-Blog]
Plattformarbeit: Tarifverhandlungen für bessere Arbeitsbedingungen
Auf europäischer Ebene gibt es schon seit einigen Jahren eine öffentliche Debatte über die rechtlichen Rahmenbedingungen von Plattformarbeit. Gerade im Zuge der COVID-19-Pandemie, wo sowohl Restaurants als auch große Teile des stationären Handels geschlossen sind, haben Online-Plattformen an Bedeutung gewonnen. Zugleich hat die Pandemie auch die vielfach prekären Beschäftigungsverhältnisse von Plattformarbeitern sichtbar gemacht. Die Europäische Kommission arbeitet derzeit an einer Initiative zur Anpassung des EU-Wettbewerbsrechts. Die Initiative sieht vor, dass künftig Tarifverhandlungen nicht mehr nur für Arbeitnehmer, sondern auch für schutzbedürftige Selbstständige möglich sein sollen.
05.04.2021 12:20:09 [Norbert Häring]
Arbeitnehmerrechte sind keine Jobkiller
Die vom kapitalnahen Mainstream der Ökonomie gern verbreitete These, dass eine Deregulierung des Arbeitsmarktes gegen Arbeitslosigkeit helfe, lässt sich mit wissenschaftlichen Erkenntnissen nicht belegen. Infolge der Finanzkrise 2007/2008 schnellten die Arbeitslosenquoten in Europa in die Höhe. Als die Arbeitslosigkeit in zahlreichen europäischen Ländern für eine längere Zeit erhöht blieb, kristallisierte sich bald eine dominante Interpretation heraus: Die erhöhte Arbeitslosigkeit müsse durch „Strukturreformen“ der Arbeitsmarktinstitutionen abgebaut werden.
05.04.2021 14:06:19 [Der Freitag]
Frauensache Informatik
Verdrängung: Erst als Löhne, Prestige und Einfluss stiegen, fluteten Männer das Berufsfeld – mit Folgen. Als Isabelle Collet Ende der 1980er Jahre in Reims Informatik studiert, gehört sie zu einer Minderheit von knapp 30 Prozent. Nach dem Studium findet Collet keinen Job. Arbeitgeber sehen in ihr nicht die Spezialistin für digitale Signalverarbeitung, sondern eine junge Mutter. Als solche passt sie nicht ins Schema. „Was willst du denn?“, heißt es, wenn sie sich darüber beklagt. „Das ist halt eine Männerwelt.“ Heute liegt der Frauenanteil in der IT in technischen Positionen – Support, HR und Marketing ausgeschlossen – in der Schweiz und in Europa sogar bei weniger als 15 Prozent.
05.04.2021 15:53:22 [Arbeitermacht]
Tarifabschluss Metallindustrie: Kapitulation total!
Es hatte sich abgezeichnet, dass vor Ostern ein Abschluss hermusste. Am 31. März wurde er für Nordrhein-Westfalen fertig verhandelt, später folgten Baden-Württemberg und die anderen Tarifgebiete. Auch für die Stahlindustrie war im Nordwesten schon ein Abschluss erfolgt, der die Linie vorgezeichnet hatte.

Auch dieses Jahr gibt es keine Erhöhung der Löhne und Gehälter oder – um das Tarifvokabular zu benutzen – der Monatsentgelte. Diese wurden zuletzt im April 2018 um 4,3 % erhöht. Die nächste mögliche Erhöhung kann ab Oktober 2022 kommen: also mindestens viereinhalb Jahre Stillstand.

Es gibt trotzdem mehr Geld: für 2021 eine Einmalzahlung von 500 Euro netto.

05.04.2021 17:28:30 [Tagesschau]
Werkstatt wehrt sich gegen gekürzte Löhne
"Manche waren wütend, manche haben geweint. Das war eine der schwersten Aufgaben in meiner Zeit seit ich im Werkstattrat bin", erinnert sich Uli Eimermann. Und meint damit den Tag, als die Belegschaft der Werkstätten für Menschen mit Behinderung der Arbeiterwohlfahrt (AWO) in Siegen erfuhr, dass die Löhne gekürzt werden. Das war im Januar.

Der 54-Jährige sitzt in seinem Büro in der Werkstatt. Durch die Tür sieht er die Kollegen arbeiten. Hier schneiden sie zum Beispiel Gewinde, gravieren per Laser Firmenlogos oder verpacken Schrauben für die Industrie. Die Arbeit ist an die Handicaps der Beschäftigten angepasst.

06.04.2021 06:59:33 [EurActiv]
Bildungssystem benachteiligt Kinder mit Migrationshintergrund weiterhin
Die Ungleichheit im deutschen Bildungssystem ist ein gut dokumentiertes Problem. Seit Jahrzehnten bestätigen Studien, dass Schüler aus besser gestellten sozioökonomischen Verhältnissen auch bei gleichen kognitiven Fähigkeiten durchweg besser abschneiden als ihre Altersgenossen. Diese Kinder werden eher für die höchsten Bildungsschienen empfohlen und haben eine höhere Wahrscheinlichkeit eine Universität zu besuchen.

Der im Januar veröffentlichte Bildungsbericht 2020 der Bundesregierung stellt fest: „Die [sozioökonomische] Herkunft prägt nicht nur den Übergang auf die weiterführenden Schulen, sondern spielt auch für die weitere Schullaufbahn eine wichtige Rolle.“

06.04.2021 11:21:23 [Junge Welt]
Ausgebeutete Feldarbeiter
Ohne sie geht nichts bei deutschen Gemüsebauern: Saisonarbeiter aus Osteuropa. In diesem Jahr arbeiten sie wieder zu Tausenden auf den Feldern der BRD, stechen Spargel und pflücken Erdbeeren und Gurken. Im Schnitt sind es 280.000 Personen, die Jahr für Jahr nach Deutschland kommen. Diesmal werden erstmals auch gezielt Personen aus Georgien für die harte Arbeit rekrutiert.

Rund 5.000 Georgier sollen bei der Spargelernte eingesetzt werden, bestätigte die Bundesagentur für Arbeit (BA) auf Nachfrage. In Zusammenarbeit mit der georgischen Arbeitsverwaltung seien sie ausgewählt und an deutsche Betriebe vermittelt worden.

06.04.2021 13:07:30 [Telepolis]
Wenn Pflegekräfte mit den Füßen abstimmen
Bis 2030 könnten in Deutschland und der EU Millionen Fachkräfte fehlen. Von den einen gefeiert - von den anderen kritisch betrachtet: Das Echo auf die siebenstündige Pflegedokumentation der Entertainer Joko und Klaas könnte nicht unterschiedlicher sein. Aufgenommen mit einer Bodycam und in Echtzeit wurde in der Nacht zu Gründonnerstag auf Pro Sieben eine Schicht einer Krankenpflegerin im Knochenmark- und Transplantationszentrum der Uniklinik Münster gezeigt. Gelobt wurde die Sendung unter dem Motto #Nichtselbstverständlich auch von Bundesgesundheitsminister Jens Spahn (CDU) und SPD-Kanzlerkandidat Olaf Scholz.
06.04.2021 16:47:02 [Junge Welt]
Minuspunkte im Südwesten
Dem am vergangenen Dienstag in der nordrhein-westfälischen Metall- und Elektroindustrie erzielten Pilotabschluss sind bereits weitere Tarifgebiete gefolgt. Der IG-Metall-Bezirk Mitte, der die Bundesländer Hessen, Rheinland-Pfalz, Saarland und Thüringen umfasst, zog schon am Mittwoch nach. Ebenso Baden-Württemberg, wo sonst oft Pilotabschlüsse gefunden werden. Dort war der Unternehmerverband Südwestmetall unter seinem Vorsitzenden, dem Daimler-Personalvorstand Wilfried Porth, in den vergangenen Wochen besonders provokativ aufgetreten.
06.04.2021 18:42:52 [NachDenkSeiten]
Mut – ganz praktisch betrachtet
Die Sicht eines Philosophen: Matthias Burchardt im Gespräch. Nicht erst seit, aber besonders in Zeiten von Corona ist es gar nicht so leicht, einer gängigen Meinung entgegenzutreten. Angefangen von heftigen Auseinandersetzungen und Trennungen innerhalb des Freundeskreises oder der Familie, über Ärger beim Einkaufen, Reputationsverlust bis hin zu Verlust von Arbeitsplatz, Bankkonten, Wohnung und auch Hausdurchsuchungen: Wer die „falsche“ Meinung hat, wer diese auch noch öffentlich und offensiv vertritt, riskiert auch den Besuch eines SEKs morgens um sechs Uhr. Da wirkt dann das Prinzip „Strafe einen, erziehe viele“ hervorragend, und es braucht gehörigen Mut, weiter der eigenen Überzeugung gemäß zu handeln.
06.04.2021 18:54:33 [IPG - Internationale Politik und Gesellschaft]
Die Radikalität eines größeren Wir
Vor mehr als einem Jahr, im Februar 2020, trug ein wesentlicher Umstand zur raschen Verbreitung des neuartigen Coronavirus in Norditalien bei, der mittlerweile fast wieder in Vergessenheit geraten ist: Zehntausende chinesische Näher ohne gültigen Aufenthaltsstatus, die in den großen Modemetropolen des Landes unter teils menschenunwürdigen Bedingungen tätig waren, hatten weder Krankenversicherung noch Zugang zur Gesundheitsversorgung. Im Falle einer Infektion konnten sie sich weder kostenfrei testen lassen noch ausreichend isolieren.

Aus Angst vor Abschiebung und hohen Kosten blieb ihre Erkrankung unbehandelt, in den engen Behausungen und Arbeitsstätten wurde das Virus rasch weitergegeben.

07.04.2021 09:30:10 [Deutschlandfunk Kultur]
Trucker aus Osteuropa: Lange Fahrten für wenig Geld
Monatelang unterwegs, ohne jemals ein Hotel zu sehen, zu Dumpinglöhnen: Die Ausbeutung von LkW-Fahrern auch auf Straßen hierzulande spitzt sich zu. Kontrollen sind schwierig und die Methoden der osteuropäischen Speditionsfirmen werden immer krimineller.

Die Autobahnraststätte Michendorf, 35 Kilometer südlich von Berlin. Ein Samstagvormittag Mitte Februar, es liegt Schnee, ein eisiger Wind weht über den Parkplatz, auf dem dicht an dicht schwere Lastwagen stehen. Fast alle kommen aus Osteuropa, aus Polen, Rumänien oder Litauen.

Michael Wahl ist mit einem kleinen Team ausgerückt, er arbeitet für das DGB-Projekt „Faire Mobilität“.

07.04.2021 17:06:44 [Neues Deutschland]
Erntehelfer: Eingeflogen, ausgebeutet, infiziert
Der Bundesregierung ist das Wohl der Agrarlobby weiterhin wichtiger als das der Erntehelfer. Der DGB warnt vor »unverantwortbaren Zuständen bei der Ernte«, die IG BAU spricht von »staatlich verordnetem Sozialdumping«. Wer dieser Tage aufmerksam die Zeitung liest, fühlt sich unweigerlich an das letzte Jahr erinnert. Wie nie zuvor waren die katastrophalen Bedingungen der ausländischen Saisonarbeitskräfte in der deutschen Landwirtschaft in die mediale Öffentlichkeit geraten. Um die pandemiebedingten Einschränkungen des Personenverkehrs zu den Nachbarländern zu umgehen, wurden im April und Mai 2020 Zehntausende osteuropäische Erntehelfer per Luftbrücke eingeflogen.
07.04.2021 18:51:56 [Seniorenaufstand]
EU-Kommission droht: wir kümmern uns um eure Renten!
Die Europäische Union hat die Rentenpolitik zu ihrem Betätigungsfeld erklärt. Auf ihrer Agenda steht die Verlängerung der Lebensarbeitszeit über 70 Jahre hinaus und die forcierte Privatisierung der Altersversorgung. Es ist höchste Zeit, den Widerstand gegen die Pläne der EU-Kommission zu organisieren – europaweit. In ihrer Antrittsrede als EU-Kommissionspräsidentin erklärte Ursula von der Leyen: „Dreh- und Angelpunkt der Arbeiten (der Kommission) ist die Notwendigkeit, auf den Klimawandel sowie auf die technologischen und demografischen Entwicklungen zu reagieren…“ (10.9.2019).

Seit Juni 2019 gibt es die EU-Verordnung zu einem „Paneuropäischen Privaten Pensionsprodukt“ (PEPP) und seit Januar dieses Jahres gibt es das „Green Paper on Ageing“.

08.04.2021 06:55:45 [A&W-Blog]
Arbeitszeiten zwischen Autonomie und Fremdbestimmung
Flexible und hochgradig selbstgesteuerte Arbeitszeiten ohne Zeitaufzeichnung sind in vielen Fällen mit langen Arbeitszeiten verbunden. Das Risiko für unbezahlte Überstunden steigt stark an, wie schon eine FORBA-Studie aus 2018 zeigt, die derartige Arbeitszeitarrangements, ihre Formen und ihre tatsächliche Verbreitung am Arbeitsmarkt untersucht hat.

Die Mehrzahl der Arbeitnehmer in Österreich arbeitet nach wie vor mit fix vorgegebenen Arbeitszeiten. Selbstgesteuerte und flexible Arbeitszeiten haben vor allem Menschen mit höheren Bildungsabschlüssen. Mit selbstgesteuerten und flexiblen Arbeitszeiten werden im Durchschnitt mehr Arbeitsstunden geleistet als mit fix vorgegebenen.

08.04.2021 11:21:31 [Telepolis]
Arbeiten bis 69 als Antwort auf "Fachkräftemangel"
Droht bis 2040 ein so gravierender Fachkräftemangel, wie ihn das Instituts der deutschen Wirtschaft (IW) in einer neuen Studie an die Wand malt, um neben qualifizierter Zuwanderung auch ein höheres Renteneintrittsalter zu fordern?

Im negativsten Szenario des Instituts liegt der Fachkräfteschwund bis 2040 in Deutschland bei 4,2 Millionen, was etwa zwölf Prozent entspricht. Übrig wären dann rund 31,2 Millionen. Bei "sehr positiven Verläufen" in den Bereichen Zuwanderung und Erwerbsbeteiligung älterer Menschen könne die "die Zahl der am Arbeitsmarkt aktiven Fachkräfte zwischen 20 und 69 Jahren" aber nahezu konstant bleiben, heißt es in der am Mittwoch veröffentlichten Studie.

08.04.2021 11:26:00 [Junge Welt]
Azubis in Sorge
Pandemie erschwert Ausbildung. Gewerkschaften warnen vor Stigmatisierung der »Coronajahrgänge«. Anlässlich der bevorstehenden Abschlussprüfungen für Auszubildende hat die Industriegewerkschaft Bauen, Agrar, Umwelt (IG BAU) vor coronabedingten Nachteilen für die Azubis gewarnt. In einer Pressemitteilung vom Mittwoch forderte Nicole Simons, Bundesvorstandsmitglied und zuständig für die Junge BAU, Auszubildende auf dem Arbeitsmarkt nicht als sogenannte Coronajahrgänge mit geringer Qualifizierung zu stigmatisieren. Es sei zu verhindern, dass ihnen bei Bewerbungen aufgrund der Pandemie Nachteile entstünden.
09.04.2021 06:36:27 [A&W-Blog]
Digitaler Wandel darf nicht zu digitaler Krise werden
Die COVID-19-Krise hat der Digitalisierung der Arbeitswelt einen Schub gegeben. In Österreich arbeitet jeder Fünfte in der Krise erstmals im Homeoffice. Viele Organisationen mussten ihre Prozesse rasant umstellen. Arbeiten auf der „Cloud“ ist nicht mehr Science-Fiction, sondern für viele mittlerweile Arbeitsalltag. Auch bei Tätigkeiten, die normalerweise keine Arbeit am Computer erfordern (z. B. im Sozialbereich) erfolgen administrative Schritte wie Zeiterfassung oder Urlaubsanträge nun auf digitalem Weg. Damit kann der Arbeitsalltag für viele zwar einigermaßen aufrechterhalten werden, diese Entwicklungen schaffen aber auch neue Hürden.
09.04.2021 06:43:42 [Junge Welt]
Schönrechnen hilft nicht: Quatsch aus Wiesbaden
Gute Nachrichten vom Statistischen Bundesamt: Uns Deutschen geht es prima! Die Beschäftigten profitieren von rasant steigenden Löhnen – 28,5 Prozent Zuwachs seit 2010! Auch die Geldbörsen der Rentner werden immer dicker – 25,7 Prozent Rentenplus seit 2010 im Westen, 37,7 Prozent im Osten.

Das erinnert an die Zeit des großen Sozialkahlschlags der späten 1990er und frühen 2000er Jahre, als die ständige Verschlechterung der Lebenslage der Bevölkerungsmehrheit in der Alltagswahrnehmung offensichtlich war, während ständig irgendwelche Daten breitgetreten wurden, die das Gegenteil behaupteten.

09.04.2021 06:57:09 [Telepolis]
Sorge um sozialen Frieden
Der Streit innerhalb der Großen Koalition um das Betriebsrätemodernisierungsgesetz hat die Öffentlichkeit wenig bewegt und wurde lediglich von den Verbandsvertretern und vonseiten der Gewerkschaften ausführlicher kommentiert.

Anlass für die Reform ist der Bedeutungsverlust der Vertretung deutscher Arbeitnehmer durch Betriebsräte - eine fortschreitende "Erosion der betrieblichen Mitbestimmung", wie sie etwa von der Linken beklagt wird. Die SPD hatte seinerzeit eine Novellierung des Betriebsverfassungsgesetzes in die Koalitionsvereinbarung eingebracht und Arbeitsminister Hubertus Heil im Dezember 2020 einen Referentenentwurf mit dem Titel "Betriebsrätestärkungsgesetz" vorgelegt.

09.04.2021 11:14:28 [Manager Magazin]
Olaf Scholz senkt Renten bei Riester, Rürup und Co.
Sparen Sie für eine Riester- oder Rürup-Rente? Zahlen Sie brav regelmäßig in eine Direktversicherung beim Arbeitgeber oder einfach in einen privaten Rentenversicherungsvertrag ein? Dann gilt Ihnen an dieser Stelle mein ausdrückliches Bedauern. Bei sehr vielen Verträgen werden demnächst die garantierten Renten gesenkt. Die Verordnung, die daran schuld ist, kommt aus dem Bundesfinanzministerium von Olaf Scholz und wird in brachialer Geschwindigkeit, ohne Einbezug von Parlament oder Bundesländern, durchgepeitscht. Ein vermutlich erwünschter Nebeneffekt: Für neue Rentenversicherungsverträge gehen die Provisionen für die Vertreter in ungeahnte Höhen.
09.04.2021 11:17:39 [Junge Welt]
Ausbeutung im Schlachthof: Mit allen Mitteln
Fleischindustrie versucht mit Tricksereien bessere Bedingungen für Beschäftigte zu vermeiden. In der Fleischindustrie rumort es weiter. Das Aus für Werkverträge in der Branche hat einiges verändert, aber aus Sicht des Deutschen Gewerkschaftsbundes (DGB) muss noch viel getan werden. In der Kritik stehen neben der Wohnsituation von vielen Beschäftigten die geringen Löhne. Szabolcs Sepsi ist für die DGB-Beratungsstelle »Faire Mobilität« in Dortmund tätig. Gegenüber dpa sagte er am Donnerstag, er höre noch immer oft, dass Beschäftigte beengt wohnen müssten – teilweise zu sechst in einer Wohnung mit drei Räumen.
09.04.2021 13:15:59 [WSWS]
Kampf der WISAG-Arbeiter am Scheideweg
Die Bodenarbeiter am Frankfurter Flughafen haben mit ihrem mutigen Kampf gegen den WISAG-Konzern bereits etwas Wichtiges erreicht: Sie haben den Medien, den etablierten Parteien und der Gewerkschaft Verdi die Maske vom Gesicht gerissen und die gesellschaftlichen Verhältnisse so gezeigt, wie sie tatsächlich sind.

Die Politiker und Gewerkschaftsfunktionäre, die gerne über „Sozialpartnerschaft“ und „soziale Marktwirtschaft“ schwadronieren, sind den entlassenen Arbeitern in den Rücken gefallen und haben sich hinter den WISAG-Konzern gestellt, der die Corona-Pandemie skrupellos nutzt, um qualifizierte Arbeiter zu entlassen und durch schlecht bezahlte und jederzeit kündbare Zeitarbeiter zu ersetzen.

09.04.2021 16:03:39 [WOZ - Die Wochenzeitung]
Die Google-Gewerkschaft: Nach dem Bällebad in den Arbeitskampf
Die Techfirmen traten an, eine bessere Welt zu erschaffen. In ihrem Hightech-Liberalismus brauchte es keine Gewerkschaften. Doch langsam, aber stetig organisieren sich die Arbeiter bei Google – auch in Zürich. Am ersten Arbeitstag des neuen Jahres 2021 ging eine Nachricht aus den Vereinigten Staaten um die Welt. So meldete die «New York Times» am 4. Januar: «Hunderte Google-Angestellte gründen eine Gewerkschaft.» Das mag manche überrascht haben, vorausgegangen war der Gewerkschaftsgründung aber ein facettenreicher, langer Kampf, nicht nur in den USA.
09.04.2021 17:11:57 [Der Freitag]
Was ist Freiheit?
Wie frei kann das Individuum sowohl autark als auch in einer Gesellschaft sein? Die Freiheit ist ohne die Unfreiheit nicht zu denken. Für die Freiheit stehen alle ein. Unabhängig von politischer Ideologie und Weltanschauung ist die Einigung, im Zweifel für die Freiheit einzustehen, Minimalkonsens. Dass die Freiheit dabei unterschiedlich interpretiert wird, liegt in ihrem Wesen. Freiheit kann ökonomisch, gesellschaftlich, ökologisch und der gleichen mehr aufgefasst werden. Dass sie sich hierbei mitunter diametral gegenübersteht, ist ebenfalls ihrem Wesen geschuldet: die Notwendigkeit der Freiheit resultiert aus einer Unfreiheit.
09.04.2021 17:21:39 [IPG - Internationale Politik und Gesellschaft]
Die Welt ist endgültig ein Dorf
Durch die globale Vernetzung verschärft sich der Konkurrenzkampf um Arbeitsplätze. Besonders bedroht ist die Mittelschicht in den Industrieländern. Vor einer Woche wurde ich per E-Mail zu einer Tagung eines Verbunds von Wirtschaftshistorikern der Balkanstaaten eingeladen. Diesen Verbund gibt es schon seit einigen Jahren, aber ich hatte es bis dato nie geschafft, zu einer seiner Tagungen anzureisen, obwohl ich es mich sehr interessiert hätte, dabei zu sein. Dafür hätte ich allerdings zu einem bestimmten Termin physisch in Belgrad anwesend sein müssen. Wegen des Lockdowns fand die Tagung nun als Online-Meeting statt, sodass ich über eine Entfernung von mehreren tausend Meilen hinweg von Washington D. C. aus teilnehmen konnte.
09.04.2021 18:51:06 [Heise]
Schule digital: Wie ein Lock-In an Schulen der Gesellschaft schadet
Überstürzt wurden in den vergangenen Wochen und Monaten an Schulen neue Geräte und Software angeschafft, um in der Coronavirus-Pandemie Distanzunterricht oder auch Hybridunterricht zu ermöglichen. Doch was den Unterricht während der Pandemie schnellstmöglich sichern sollte, wird auf lange Zeit negative Auswirkungen auf unser Bildungswesen und unsere freiheitlich-demokratische Gesellschaft haben. Wir verschärfen dadurch den Lock-In-Effekt. Aber was ist der Lock-In-Effekt eigentlich? Der Begriff des Lock-In-Effekts stammt aus der Betriebswirtschaft und den Wirtschaftswissenschaften.
10.04.2021 13:16:33 [DGB Niedersachsen]
Mehrfachbeschäftigung: Wenn ein Job nicht zum Leben reicht
Nicht erst seit der Pandemie haben viele Beschäftigte mit geringen Einkommen zu kämpfen. Diese zwingen sie häufig in einen Nebenjob. Die Mehrfachbeschäftigung hat um über 160 Prozent zugenommen. Ein unhaltbarer Zustand. Fakt ist: Auch wenn Arbeitsplätze erhalten wurden, sind viele Menschen einem großen finanziellen Druck ausgesetzt. Das gilt zuerst für die Beschäftigten, die in den vom Lockdown betroffenen Branchen tätig sind. Sie haben aktuell mit herben Einkommensverlusten zu kämpfen. Allerdings gab es bereits vor der Pandemie genug Personen, die aufgrund von Lohndumping mehr schlecht als recht mit ihrer täglichen Arbeit über die Runden kamen.
10.04.2021 13:35:19 [Telepolis]
EU-Kommission droht: Wir kümmern uns um eure Renten!
Auf der Agenda: Verlängerung der Lebensarbeitszeit über 70 Jahre hinaus und forcierte Privatisierung der Altersversorgung. Die Europäische Union hat die Rentenpolitik zu ihrem Betätigungsfeld erklärt. Auf ihrer Agenda steht die Verlängerung der Lebensarbeitszeit über 70 Jahre hinaus und die forcierte Privatisierung der Altersversorgung. Es ist höchste Zeit, den Widerstand gegen die Pläne der EU-Kommission zu organisieren - europaweit. Seit Juni 2019 gibt es die EU-Verordnung zu einem "Paneuropäischen Privaten Pensionsprodukt" (Pepp) und seit Januar dieses Jahres gibt es das "Green Paper on Ageing". Beide Projekte müssen als Bedrohung für die Altersversorgung in Europa angesehen werden.
10.04.2021 18:44:01 [Neues Deutschland]
Pflegenotstand - na und?
Jens Spahn verspricht Verbesserungen in der Altenpflege. Doch die Vorschläge aus seinem Ministerium alarmieren nicht nur die Gewerkschaft Verdi. Wenn gesetzlich Versicherte zum Arzt gehen, übernimmt die Krankenversicherung die Vergütung. Wenn alte Menschen Hilfe brauchen, zahlt die gesetzliche Pflegeversicherung nur einen Teil der Kosten. Das ist ein Grund dafür, dass Beschäftige in der Altenpflege oft gering entlohnt werden. Inzwischen hat sich die Bundesregierung vorgenommen, die Bezahlung zu verbessern. So heißt es in einem Arbeitsentwurf für eine Pflegereform aus dem Gesundheitsministerium, dass »beruflich Pflegende künftig mindestens nach Tarif entlohnt werden müssen«.
11.04.2021 07:15:31 [Gegenblende]
Die neue Arbeitswelt des Home-Office
Auch nach Corona werden viele Beschäftigte öfter zuhause arbeiten. Doch die Vereinzelung hat ihre Tücken. Das mobile Arbeiten muss daher endlich so geregelt werden, dass es flexibel und zugleich planbar für die Betroffenen ist. Nur so profitieren sie und die Unternehmen. Die Sache mit der Wendejacke ist lustig, zeigt aber auch das Problem. Eine Patientin, so erzählt der Psychiater Bastian Willenborg, trage im Corona-Lockdown im Home-Office eine Wendejacke, um den Unterschied zwischen Arbeit und Freizeit zu markieren. Während der Arbeitsstunden war die eine Seite der Jacke außen, nach Feierabend wurde die Jacke umgedreht.
11.04.2021 11:54:24 [Telepolis]
Das Spannungsfeld zwischen Freiheit und Solidarität
Wie die Corona-Krise einen alten Konflikt der offenen Gesellschaft zuspitzt. Lange haben es die Menschen im Corona-Lockdown ausgehalten, sind den sich in Härte und Striktheit immer wieder verändernden Anweisungen ihrer Regierungen einigermaßen gehorsam gefolgt, haben sich dem proklamierten "Gebot der Vernunft" gefügt. Doch nun erleben wir zunehmende Proteste und Demonstrationen, explizit vorgetragene Verletzungen der gesetzlichen Gebote und seit neuestem auch scharfe Äußerungen gegen die Einschränkungen des öffentlichen Lebens von Seiten der Intellektuellen.
11.04.2021 13:22:24 [Junge Welt]
Arbeitsmarktpolitik: Ein Job reicht nicht
Eins, zwei, drei Jobs parallel. Für zahlreiche Beschäftigte ist das längst Alltag – in Niedersachsen etwa. Der DGB-Bezirk Niedersachsen, Bremen, Sachsen-Anhalt legte hierzu am Donnerstag eine Kurzstudie vor. Der Fakt: Von 2003 bis 2020 hat die Mehrfachbeschäftigung in dem Bundesland enorm zugenommen, konkret um 160 Prozent. Oder in Zahlen: von knapp 120.000 auf 311.000 Beschäftigte.

Die Gründe liegen auf der Hand. Der Landesvorsitzende des DGB Niedersachsen, Mehrdad Payandeh, sagte am Freitag gegenüber jW: »Die Zunahme der Nebenjobs ist die direkte Folge von Niedriglöhnen.«

11.04.2021 17:00:43 [Sozialismus Aktuell]
Tarifpolitik in der Corona-Krise
Nach Warnstreiks von rund einer Million Metaller und sieben Verhandlungsrunden gelang in der nordrhein-westfälischen Metall- und Elektroindustrie der Durchbruch. Die Tarifparteien einigten sich auf einen Pilotabschluss für bundesweit rund 3,9 Millionen Beschäftigte.

Die Tarifeinigung enthält neben einem relativ bescheidenen Entgeltzuwachs auch innovative Elemente, mit denen sich die Transformation der Industrie besser gestalten lassen könnte, sofern die Arbeitgeber mitspielen.

Die IG Metall war mit der Forderung nach vier Prozent mehr Geld in die Tarifrunde gestartet.

11.04.2021 18:45:44 [Die Freiheitsliebe]
Die Bundesregierung und die Personalpolitik in deutschen Krankenhäusern
Immer mehr Kliniken lagern Personal in Servicegesellschaften aus, um Geld zu sparen: Das geht meist auf Kosten der Beschäftigten und der Gesundheit der Patienten. Die Coronakrise hat an vielen Stellen Missstände offengelegt. So auch die Gefahren, die entstehen können, wenn die Versorgung der Patienten durch den massiven Anstieg von Outsourcing in Kliniken und Krankenhäusern beeinträchtigt wird. Outsourcing, also das Auslagern diverser Arbeitsbereiche in untergeordnete Servicegesellschaften, gehört zu einer der gravierendsten Fehlentwicklungen in den Krankenhäusern. Unsere Kleine Anfrage hat ergeben, dass sich die Personalausgaben in diesen Bereich zwischen 2010 und 2018 verdoppelt haben.
 Gesundheit, Gesundheitswesen, Gesundheitspolitik, Medizin, Ernährung (24)
01.04.2021 07:00:17 [TAZ]
Die Kliniken sollen bluten
In der Stadt formiert sich der Widerstand gegen den massiven Stellenabbau bei den vier kommunalen Bremer Krankenhäusern. Dabei muss sich die linke Gesundheitssenatorin Claudia Bernhard – sie ist zugleich die Aufsichtsratsvorsitzende der Klinikholding Gesundheit Nord (Geno) – auch aus der eigenen Partei viel Kritik anhören.

Rund 440 Vollzeitstellen sollen in den vier Bremer Krankenhäusern bis 2024 gestrichen werden. 90 davon im ärztlichen Bereich, der Rest beim Verwaltungspersonal sowie bei den Beschäftigten in nicht-medizinischen Bereichen wie etwa den Großküchen. Auch von einem Abbau von 250 Betten ist die Rede.

01.04.2021 11:43:42 [ScienceFiles]
Das Wuhan-Virus macht die Bundesregierung immer mehr zum Außenseiter
Vom 14. Januar 2021 bis zum 10. Februar 2021 hat sich ein Team der WHO in China herumgedrückt, um die Herkunft von SARS-CoV-2 zu klären. Das Ganze hat sich als eine große Übung in Sinnlosigkeit erwiesen, denn wir sind nun, nachdem das Team aus Wuhan zurückgekehrt ist und nachdem es sich außerhalb der direkten Zensurmöglichkeiten der Kommunistischen Partei Chinas (KPCh) befindet, nicht klüger als wir es zuvor waren, denn die KPCh hat nicht nur im Vorfeld bereits unzählige notwendige Informationen beseitigt oder nicht mehr zugänglich gemacht, die Team-Mitglieder haben auch nur das gesehen, was ihnen die KPCh zeigen wollte.
01.04.2021 15:23:45 [Der Freitag]
„Es ist unmöglich, auf null zu kommen“
Der Epidemiologe Anders Tegnell über Schwedens Sonderweg, Fehler bei der Pandemiebekämpfung und Hassmails. Der Freitag: Herr Tegnell, in Schweden gab es zuletzt mehr als 6.000 Neuinfektionen täglich und zehn bis 20 Todesfälle. Sind Sie besorgt?

Anders Tegnell: Wir wollen die Zahl der Neuinfektionen auf jeden Fall senken. Es ist unmöglich, auf null zu kommen – außer vielleicht an Orten wie Neuseeland und Island. Die Belastung des schwedischen Gesundheitssystems ließ in den vergangenen Monaten stark nach. Aber wir sind auf einem Level, wo selbst kleine Abweichungen im Verhalten der Menschen die Fallzahlen schnell erhöhen können.

02.04.2021 12:15:33 [ScienceFiles]
b.1.1.7, die “britische Mutation” widersetzt sich den professionellen Panikverbreitern
Es ist kein Aprilscherz, dass man heute einmal mehr und dieses Mal im ZDF von der “besorgniserregenden britischen Corona-Variante” b.1.1.7 lesen kann, jener Variante, in die die professionellen Hysteriker und Verbreiter von Panik, die auf dem Rücken von SARS-CoV-2 anscheinend eine ganz eigene Agenda verfolgen, so viel Hoffnung gesetzt haben. Ein Indiz, das regelmäßig angeführt wird, um die Behauptung, b.1.1.7 sei ansteckender als bisherige Varianten, zu stützen, ist die sogenannte Virenladung, von der angenommen wird, dass sie in einem umgekehrten Verhältnis zum ct-Wert eines RT-PCR-Tests steht. Der ct-Wert gibt an, wie viele Zyklen durchlaufen werden müssen, um z.B. in einem Nasenabstrich genügend genetisches Material zu finden, um SARS-CoV-2 nachweisen zu können.
02.04.2021 18:51:44 [RT DE]
Testen an Menschen?
STIKO empfiehlt nach AstraZeneca-Stopp anderen Impfstoff für unter 60-Jährige. Bereits am 26. März warnte die STIKO das Kanzleramt, den AstraZeneca-Impfstoff nicht mehr an Patienten unter 60 zu verabreichen. Merkel schwieg bis zum 30. März. Die STIKO empfiehlt daher den unter 60-Jährigen, einen anderen Impfstoff als zweite Dosis zu nehmen – trotz ungewisser Verträglichkeit. Der STIKO-Vorsitzende Thomas Mertens sagte im Interview mit dem Nachrichtenmagazin "Spiegel" dazu, dass Daten aus Tierexperimenten zeigten, "dass die Immunreaktion nach heterologer Zweitimpfung gleich ausfällt". Allerdings müsse noch geklärt werden, "wie gut der Schutz dann beim Menschen ist". Mertens hofft, "dass dazu bald Daten vorliegen".
03.04.2021 06:41:25 [Sozialismus Aktuell]
Das kaputte Geschäftsmodell der pharmazeutischen Industrie
Mit der Zulassung von Impfstoffen gegen eine Infektion mit dem Corona-Virus ist der Kampf gegen die Pandemie in ein neues Stadium eingetreten. In vielen Ländern wird seit Ende des Jahres 2020 gegen das Coronavirus Sars-CoV-2 geimpft. Noch nie wurden Impfstoffe so schnell zur Zulassung gebracht wie in dieser Pandemie.

Es kostet viel Geld, Impfstoffkandidaten zu finden, die Produkte durch die klinische Prüfung zu bringen, zu produzieren und auszuliefern. Die USA und die Europäische Union haben in den zurückliegenden Jahren massive öffentliche Investitionen für Forschung und Entwicklung zur Verfügung gestellt.

03.04.2021 11:38:07 [Norbert Häring]
Das RKI täuscht, um die Inzidenz-Propaganda zu unterfüttern
Während für jeden denkenden Menschen offensichtlich ist, dass die starke Ausweitung der Schnell-, Selbst- und PCR-Testungen einen beträchtlichen Einfluss auf die sogenannte 7-Tage-Inzidenz hat, erweckt das Robert-Koch-Institut den Eindruck, das Gegenteil sei der Fall. Das aber würde bedeuten, dass die Massentest-Strategie gescheitert wäre.

Seit einigen Wochen, seit millionenfach Schnell- und Selbsttests eingesetzt werden, werden wir Tag für Tag mit der steigenden Anzahl der positiv Getesteten und der davon direkt abgeleiteten 7-Tage-Inzidenz traktiert, während praktisch alle anderen, relevanteren, Indizien für die Gesundheitslage der Nation ausgeblendet werden.

04.04.2021 11:22:15 [Junge Welt]
»Gesundheit gehört in öffentliche Hand«
Plädoyer gegen Ökonomisierung medizinischer Daseinsvorsorge. Ein Gespräch mit Dana Lützkendorf: Wie ist die aktuelle Lage auf den Intensivstationen der Berliner Charité? Und: Welche wirtschaftlichen Folgen wird die Pandemie für das Klinikum haben?

Die Covid-19-Fallzahlen steigen allmählich, und mit der absehbaren »dritten Welle« werden sie vermutlich weiter hochgehen. Da die Charité und Vivantes die medizinische Hauptlast der Pandemie tragen, wirken sich die wirtschaftlichen Folgen bei uns auch am stärksten aus. Bisher wird das Minus in den Kassen vom Staat aufgefangen, weil wir verpflichtet sind, Intensivbetten für Covid-19-Patienten vorzuhalten.

04.04.2021 18:54:37 [Infosperber]
Wenn Corona-Viren in Holzbänken lauern
Die Corona-Krise geht ins zweite Jahr. Inzwischen weiss man einiges mehr über das gefährliche Virus. So etwa, dass die Ansteckung durch Corona-Infizierte meistens direkt passiert – insbesondere dann, wenn Ansteckende sich längere Zeit in geschlossenen Räumen nahe bei Gesunden aufhalten. Wer korrekt mit Schutzmaske nur einen Moment lang vor dem Charcuterie-Regal im Einkaufszentrum neben einem (ebenfalls maskierten) Corona-Befallenen steht, der oder die riskiert schon viel weniger. Im Freien kommt es kaum zu Ansteckungen – insbesondere nicht, wenn etwas Wind herrscht. Reale Erfahrungen zeigen: Viele Corona-Opfer wissen oft genau, wann und wo sie sich in Wohnungen im Bekanntenkreis angesteckt haben.
05.04.2021 15:59:29 [Frankfurter Allgemeine Zeitung]
Tausende Operationen fallen aus
In der zweiten Welle der Pandemie sollten nicht mehr so viele Eingriffe verschoben werden wie in der ersten. Das hat nicht geklappt. Als die deutschen Krankenhäuser vor etwa einem Jahr wegen der Corona-Pandemie erstmals in den Krisenmodus versetzt wurden, fielen binnen weniger Wochen Tausende Eingriffe aus. Jede Operation, die nicht dringend erforderlich war, wurde auf bessere Zeiten verschoben – um jedes Bett, jeden Arzt und jede Pflegekraft für die Versorgung schwerkranker Covid-19- Patienten zur Verfügung zu haben. Doch die Hoffnung, dass sich die Situation in den Kliniken mit der Zeit bessert, hat sich nicht erfüllt.
05.04.2021 17:01:30 [RT DE]
Kinder, Corona und Angst-Propaganda
Ein Todesfall und mehr Kleinkinder mit COVID-19 in Kliniken? An der Nachricht, die von mehreren Medien und einer Nachrichtenagentur verbreitet wurde, ist wohl nur eines stimmig: Mehr Kinder wurden positiv getestet. Was ihnen fehlte, dazu gibt es keine Daten. Schulen werden zu Laien-Testlabors unter Lehrer-Aufsicht, Kindertagesstätten verpflichten Eltern, ihren Knirpsen Selbst-Abstriche zu entnehmen: Die Suche nach Mikropartikeln, die auf SARS-CoV-2 hindeuten, nimmt immer bizarrere Züge an.

Und wer sucht, der findet: Der öffentlich-rechtliche SWR verdächtigte schon Kinder als "neue Pandemietreiber". Die Tagesschau gibt sich als Kinderimpfexpertin, als gehörte sie inzwischen zum Propagandastab von Pfizer, AstraZeneca und Co.

05.04.2021 19:01:25 [A&W-Blog]
Kontrovers seit über 200 Jahren: die Impfpflicht
Ein Blick in die Vergangenheit lässt erkennen, dass das Thema Impfpflicht beinahe so alt ist wie die Erfindung der Impfung selbst. Auch in Österreich wurde das Thema seit jeher heiß diskutiert und wurde schlussendlich auch eine Zeit lang rechtlich realisiert. Eine Tatsache, die in Anbetracht der heutzutage eher negativen Konnotation dieses Themas kaum vorstellbar erscheint. Doch auch gesamteuropäisch betrachtet ist die Impfpflicht keine Seltenheit und wird in vielen Ländern praktiziert. Fraglich bleibt allerdings ihre Auswirkung auf die Durchimpfungsrate. Einerseits weisen nicht alle Länder mit Impfpflicht auch eine hohe Durchimpfungsrate auf, andererseits schaffen so manche Länder ohne Zwang eine vergleichbare oder sogar höhere Durchimpfungsrate.
06.04.2021 15:00:48 [Aktuelle Sozialpolitik]
Die Intensivstationen werden (wieder) voller
Auf Twitter gibt es eine teilweise mit sehr viel Humor gefüllte neue Kategorie: #laschetdenktnach. Falls jetzt jemand schon wissen möchte, ob und was dabei herausgekommen ist, so muss man dahingehend bremsen: Ostern ist ja noch nicht vorbei. »Ministerpräsident Armin Laschet (CDU) sprach sich dafür aus, über Ostern neue Wege im Kampf gegen die dritte Corona-Welle zu prüfen. Nach dem Aus für die geplante „Osterruhe“ müssten alle „gemeinsam über Ostern nachdenken“, wo weitere Schutzmechanismen eingeführt werden könnten … Es gebe aber noch nicht die Lösung.
06.04.2021 16:54:00 [ScienceFiles]
Studie zeigt die Wirkungslosigkeit von Lockdowns gegen COVID-19
Christian Bjornskov hat eine hervorragende Studie in CESifo Economic Studies veröffentlicht.

Zwar bearbeitet Bjornkov in dieser Studie ein politisch nicht korrektes Thema und findet auch deutliche Worte. Er interpretiert seine Ergebnisse aber aus unserer Sicht unnötig zurückhaltend. Aber das macht nichts: Es gibt ja uns, und deshalb schreiben wir allen Politikern, denen derzeit wieder die Saliva sprudelt, weil sie Lockdown denken, Lockdown sagen, Lockdon durchsetzen können, weil es Sykophanten gibt, die sie zum Lockdown auffordern, folgendes ins Stammbuch: Lockdown kills – wer ihn dennoch einsetzt, tut dies nunmehr mit dem expliziten Wissen, dass er über Leichen geht.

06.04.2021 16:59:52 [Telepolis]
AstraZeneca: Schwerwiegende, aber seltene Gerinnungsstörungen
Am 25. März wurde bei "Telepolis" über neue Erkenntnisse berichtet, nach denen der Corona-Impfstoff des schwedisch-britischen Pharmakonzerns Astrazeneca eine gute Wirksamkeit gegen schwere Covid-19-Verläufe auch im höheren und hohen Alter aufweist. Der Text argumentierte, dass der Impfstoff trotz des Auftretens von schwerwiegenden, aber seltenen Gerinnungsstörungen als mögliche Nebenwirkung und angesichts der bisherigen Erfahrungen bei der erfolgten millionenfachen Verimpfung weiterhin als sicher eingeschätzt wird. Bis zum 1. April haben in Deutschland laut Robert-Koch-Institut (RKI) 2,85 Millionen Personen eine erste Dosis und knapp 2.000 Menschen eine zweite Dosis des Astrazeneca-Vakzins erhalten.
07.04.2021 09:19:41 [Telepolis]
Kohle nur noch für die Pflege
"Der Markt wird es nicht richten - Gesundheit ist keine Ware", lautet das Motto beim Berliner Aktionstag für eine bessere Gesundheit am 7. April. Wie in vielen Städten nutzen auch in Berlin Beschäftigte aus dem Medizin- und Pflegebereich gemeinsam mit Unterstützern den Weltgesundheitstag, um für ihre Forderungen nach besseren Arbeitsbedingungen und mehr finanziellen Mitteln im Care-Bereich, wie der Gesundheits- und Pflegesektor genannt wird, an die Öffentlichkeit zu tragen.

Durch die Corona-Pandemie ist das Thema Gesundheit stärker in das Blickfeld der Gesellschaft gerückt. Das wollen Bündnisse in verschiedenen Städten nutzen, um Druck für konkrete Verbesserungen zu machen.

07.04.2021 11:13:01 [Infosperber]
Tödliche Pillen: Nach 11 Jahren eine Buße und bedingte Strafe
Das Diabetes- und Cholesterin-Medikament Mediator wurde mit Wissen und Zustimmung des Pharmaherstellers, Servier, immer häufiger als Appetitzügler und Schlankheitspille verwendet. Bis zum Verbot verkaufte Servier das Medikament an rund fünf Millionen Menschen.
Wegen «Tötung ohne Vorsatz», «Körperverletzung» und «schwerer Täuschung» [der Öffentlichkeit] hat ein Pariser Strafgericht das zweitgrösste Pharmaunternehmen Frankreichs Servier jetzt zu einer Buße von 2,7 Millionen Euro verurteilt. «Im Vergleich mit dem Jahresumsatz von rund 4,7 Milliarden Euro handelt es sich um eine lächerliche Buße», erklärte der Anwalt der Zivilkläger, Jean-Christophe Coubris.

07.04.2021 11:21:05 [Brave New Europe]
New COVID variants have changed the game
At the end of 2020, there was a strong hope that high levels of vaccination would see humanity finally gain the upper hand over SARS-CoV-2, the virus that causes COVID-19. In an ideal scenario, the virus would then be contained at very low levels without further societal disruption or significant numbers of deaths.

But since then, new “variants of concern” have emerged and spread worldwide, putting current pandemic control efforts, including vaccination, at risk of being derailed.

Put simply, the game has changed, and a successful global rollout of current vaccines by itself is no longer a guarantee of victory.

07.04.2021 16:25:04 [RT DE]
COVID-19-Impfungen mit Nebenwirkungen
Bundesinstitut streicht schwere Verdachtsfälle aus der Liste. Nach gehäuften Hirnvenenthrombosen stoppte Deutschland den COVID-19-Impfstoff von AstraZeneca für unter 60-Jährige. Doch die Palette an schwerwiegenden Reaktionen ist breiter, betroffen sind auch mit anderen Vakzinen Geimpfte. Im jüngsten Bericht ist davon aber keine Rede mehr. Auskunft dazu will das Paul-Ehrlich-Institut nicht geben. Seit Ende Dezember impft Deutschland gegen das Coronavirus. Die letzte Testphase der nur vorläufig zugelassenen Vakzine findet damit an der breiten Bevölkerung statt. In die öffentliche Kritik geriet insbesondere das Vektor-Serum des schwedisch-britischen Konzerns AstraZeneca.
07.04.2021 19:05:07 [NachDenkSeiten]
Zwangstests für den Schulbesuch sind abzulehnen
Nach den Osterferien droht für viele deutsche Schüler eine regelmäßige Pflicht, sich vor dem Schulbesuch auf Corona zu testen bzw. testen zu lassen. Diese Pläne sind scharf zu kritisieren: So ist die Rolle der Kinder bei der Infektionsverbreitung laut Aussagen vieler Experten untergeordnet und der medizinische Nutzen von mutmaßlich ungenauen Tests hoch umstritten. Von den permanenten psychischen Belastungen der Kinder durch wiederholte anlasslose Testungen, die jeweils einen Ausschluss aus der Gemeinschaft zur Folge haben können, ganz zu schweigen. Das Grundrecht auf Bildung unter den ständig erneuerten Vorbehalt eines zweifelhaften Tests zu stellen, ist infam.
08.04.2021 07:13:16 [Junge Welt]
Globale Gesundheitspolitik: Rette sich, wer kann
Die Situation ist dramatisch, auch hierzulande: Kliniken werden geschlossen, Krankenhausbetten abgebaut, die öffentliche Gesundheitsversorgung steht vielfach vor der Privatisierung. Das bundesweite »Bündnis Klinikrettung«, getragen vom Verein »Gemeingut in Bürgerhand« (GiB), rief am Mittwoch anlässlich des Weltgesundheitstags zu mehreren Kundgebungen auf, in Berlin am Alexanderplatz. GiB-Koordinatorin Laura Valentukeviciute sagte gleichentags im jW-Gespräch: »Seit 1991 wurden in diesem Land über 500 Krankenhäuser geschlossen.« Selbst während der Coronapandemie mussten Valentukeviciute zufolge rund 20 Kliniken dichtmachen. »Und weitere 600 Krankenhäuser sind insolvenzgefährdet.«
09.04.2021 15:52:36 [ScienceFiles]
Die COVID-19-Impfpflicht (für Kinder) wird kommen
Impflicht, so heißt es in der Zusammenfassung des Urteils der 17 Richter, die die Große Kammer beim Europäischen Gerichtshof für Menschenrechte bilden, könne in einer demokratischen Gesellschaft notwendig sein. Die Verpflichtung eines Individuums, gegen seinen Willen eine Impfung vornehmen zu lassen, wird von 15 der 17 Richter, nur die Richter aus Polen (Krzysztof Wojtycek) und Belgien (Paul Lemmens) haben sich ein abweichendes Urteil erlaubt, als demokratische Notwendigkeit gesehen und wie immer, wenn Richter solche irren Urteile fassen, wird individuelle Freiheit einer Entität am Begriffshimmel geopfert, ein Begriff, den es im Gegensatz zum konkreten Menschen, dessen Freiheitsrechte übergangen werden, nicht real existiert.
09.04.2021 18:46:00 [Der Freitag]
Pandemie: Blick auf die Statistik
Einer der zentralen Aspekte des Coronageschehens ist die Übersterblichkeit. Es gilt, diese Größe möglichst sachlich zu analysieren. Ein Blick auf das Jahr 2020. Krankheit, Tod und Sterben sind Aspekte des Lebens, mit denen man sich in normalen Zeiten nicht gerne befasst. Es gibt wichtigere und erfreulichere Themen. Im Frühjahr 2020 änderte sich das schlagartig und zwar weltweit. Nachdem man zunächst noch glaubte, dass die Ausbreitung der Coronaviren und die daraus resultierenden Erkrankungen und Todesfälle lediglich ein chinesisches Problem seien, hat man recht bald erkennen müssen, dass das Virus auch vor deutschen Grenzen nicht haltmacht.
10.04.2021 15:16:38 [RT DE]
Wie ein Zwang die Impfbereitschaft zerstören kann
Am Donnerstag entschied der Europäische Gerichtshof für Menschenrechte, dass Pflichtimpfungen legal und in einer demokratischen Gesellschaft notwendig sein können. Das Urteil bezog sich zwar auf einen Fall, in dem tschechische Familien wegen der Pflichtimpfungen für Kinder vor Gericht gezogen waren. Allerdings glauben Experten, dass das Urteil in Zukunft auch Auswirkungen auf die Impfungen gegen COVID-19 haben könnte. In den einzelnen EU-Ländern sind die Regelungen zu den bisherigen obligatorischen Impfungen gegen Krankheiten wie Masern oder Polio recht unterschiedlich. Ob eine Impfpflicht die generelle Bereitschaft zu Impfungen erhöht, ist allerdings fragwürdig.
 Wirtschaft, Ökonomie, Finanzen, Finanz- und Wirtschaftskrise, Geldsystem, Währung, Banken (58)
01.04.2021 07:02:50 [Ökonomenstimme]
Next Generation: Wie erfolgreich investiert China im Ausland?
Chinas wirtschaftlicher Aufstieg während der letzten Jahrzehnte ist enorm. Inzwischen ist das Land die zweitgrösste Volkswirtschaft der Welt. Sein Nettoauslandsvermögen betrug im Jahr 2018 rund 2,1 Billionen Dollar. Damit liegt es nach Japan und Deutschland auf dem dritten Rang. Auch im internationalen Handel ist das Land ganz vorne mit dabei. China ist inzwischen der grösste Warenexporteur weltweit.

Trotzdem blieb die Wirkung Chinas auf die globalen Finanzmärkte bisher eher bescheiden. Verantwortlich dafür ist neben anderen Gründen hauptsächlich eine strenge Regulierung.

01.04.2021 07:27:03 [Brave New Europe]
Italy’s move to avoid austerity and debt restructuring
Without Eurobonds, Italy risks a debt restructuring accompanied by austerity. The currently planned Recovery Fund is not enough to solve the EU’s problems. Brussels does not seem to be concerned about the stop to the ratification of the Recovery Fund that came from the German Constitutional Court at the end of last week. “We are convinced that the recovery plan will be launched as planned and our goal remains to complete the ratification process by the end of the second quarter of this year,” an EU spokesman said. Almost at the same time as the Karlsruhe judges pronounced their decision, Mario Draghi relaunched Eurobonds at the last European Council.
01.04.2021 15:29:20 [WOZ - Die Wochenzeitung]
Stau im Suezkanal: Buchstäblich quer gestellt
Wenn die Arbeitsteilung zum Risikofaktor wird: Die Blockade des Frachters Ever Given führt die Fragilität der globalen Vernetzung vor Augen. Eine kurze Geschichte der Lieferketten: Dieses Symbolbild hätte keine Bildagentur treffender in Auftrag geben können. Bilder prall gefüllter Containerschiffe und Kolonnen zieren seit dem ausgehenden 20. Jahrhundert die Berichterstattung über die Weltwirtschaft. Immer dann, wenn über Welthandel, Wachstum oder Globalisierungskritik berichtet wird, greifen die Bildredaktionen gerne zum Symbol des Containerschiffs.
02.04.2021 07:37:14 [WOZ - Die Wochenzeitung]
Nationalbank: Machtlos auf einem Devisenberg
Es ist ein gigantischer Devisenberg, von dem Nationalbankpräsident Thomas Jordan inzwischen auf die Schweiz hinunterblickt: Sass die Nationalbank (SNB) vor der Finanzkrise 2008 auf ausländischen Wertpapieren im Wert von 85 Milliarden Franken, sind es inzwischen beinahe eine Billion. Und der Berg dürfte weiterwachsen: Wie Jordan vor wenigen Tagen erklärte, will er falls nötig noch mehr Franken drucken, um damit weitere ausländische Wertpapiere zu kaufen.

Das Problem ist nicht die Höhe des Berges an sich, sondern dass mit dem wachsenden Berg Milliarden an Wohlstand im Land umverteilt werden. Ganz leise, beinahe unbemerkt.

02.04.2021 07:43:19 [Brave New Europe]
Strong Antitrust Policy Boosts the Economy
History shows robust antitrust enforcement helps promote a prosperous, fair, and balanced economy. Antitrust expert Mark Glick explains how the U.S. went astray during the 1980s, and how to get back on track. Lynn Parramore: Let’s go back to the beginning of antitrust policy in the United States. The Sherman Act passed in 1890, targeting monopolies and anti-competitive behavior. Why did the U.S. do this sixty years before any other country had a major antitrust statute?

Mark Glick: In the late 19th century, the rise of big business in the U.S. fostered enormous opposition from farmers, labor, and small business.

02.04.2021 14:43:35 [Kontext Wochenzeitung]
Sozialhilfe für Daimler-Aktionäre
Daimler kassiert durch Kurzarbeit viel Geld vom Staat, um durch die Krise zu kommen – und zahlt seinen Aktionären noch mehr Geld als Gewinnbeteiligung aus. In den Niederlanden ist das nach Protesten der Bevölkerung verboten worden. Paris hat den Eiffelturm, Wien ein Riesenrad und Stuttgart den Daimler-Stern. Dieses "Wahrzeichen", als welches nicht nur die Deutsche Presseagentur (dpa) das fünf Meter große Firmenlogo auf dem Turm des Hauptbahnhofes adelt, führte Zugreisende fast sieben Jahrzehnte lang an die Machtverhältnisse in der Landeshauptstadt heran. Vergangene Woche musste der Stern jedoch weichen, weil nicht einmal das Stuttgarter Erkennungszeichen den S-21-Bauarbeiten im Weg stehen darf.
02.04.2021 18:41:26 [Tichys Einblick]
Forderungen der Gläubiger steigen stark an
Die Zombifizierung der deutschen Wirtschaft schreitet offenbar voran. Im vergangenen Jahr meldeten die Amtsgerichte so wenige Unternehmensinsolvenzen wie noch nie seit Einführung der Insolvenzordnung im Jahr 1999. Trotzdem erhöhten sich die Forderungen, auf welchen die Gläubiger möglicherweise sitzen bleiben, um knapp 65 Prozent, wie das Statistische Bundesamt mitteilte. Insgesamt betrugen sie 44,1 Milliarden Euro. Der Anstieg sei darauf zurückzuführen, “dass 2020 mehr wirtschaftlich bedeutende Unternehmen Insolvenz beantragt haben als 2019”, erklärte die Behörde. Die Zahl der beantragten Unternehmensinsolvenzen lag bei 15.841 und sank damit um 15,5 Prozent im Vergleich zum Vorjahr.
02.04.2021 18:54:51 [Norbert Häring]
Corona-Lasten durch Steuern auf leistungslose Einkommen finanzieren
Die Bundesbürger werden die steuerlichen Folgelasten der Coronakrise zu spüren bekommen. Dabei ist die Abgabenbelastung schon heute im internationalen Vergleich hoch. Die Melkkühe sind die produktiven Investitionen der Unternehmen, der Verbrauch und die Arbeitseinkommen.

Bei Letzteren belegt Deutschland in den Rankings der OECD regelmäßig einen der vorderen Plätze. Dazu tragen die Sozialversicherungsbeiträge bei. Hohe Lohnnebenkosten schwächen die Wettbewerbsfähigkeit der geringer qualifizierten Arbeitnehmer. Ein zukunftsfähiges Abgabensystem geht anders.

03.04.2021 06:32:29 [Ossietzky]
Wirtschafts-Macht
Macht ist in einer Gesellschaft sowohl in der Politik als auch in der Wirtschaft zur Durchsetzung von Zielen notwendig. Sie muss aber demokratisch verliehen sein und ebenso demokratisch kontrolliert werden, und es darf auf keinen Fall zu einem Machtmissbrauch kommen. In politisch demokratischen Ordnungen ist nur der Staat als gesellschaftlicher Überbau demokratisch zur Machtausübung legitimiert. In der marktwirtschaftlich-kapitalistisch orientierten Wirtschaft herrscht jedoch bis heute, bis ins 21. Jahrhundert, geradezu selbstherrlich das »personifizierte Kapital« (Karl Marx), insbesondere gegen die vom Kapital abhängige und zur Mehrwertproduktion ausgebeutete Arbeitskraft.
03.04.2021 09:04:59 [Tagesschau]
Rückblick: Fünf Jahre Panama-Papers
Am 3. April 2016 veröffentlichten Medienhäuser aus aller Welt gemeinsam eine Recherche von bis dato unbekanntem Ausmaß: Die Panama Papers. Rund 380 Journalisten waren daran beteiligt, in Deutschland recherchierten Reporter von NDR, WDR und "Süddeutscher Zeitung" (SZ) über ein Jahr gemeinsam an den Geschichten. Fünf Jahre danach steht wohl fest, dass es selten ein journalistisches Projekt gab, das derart weitreichende Folgen nach sich gezogen hat. Deutlich über eine Milliarde Euro haben Finanzbehörden und Gerichte durch Strafgelder und Steuernachforderungen weltweit eingenommen, rund 160 Millionen davon allein in Deutschland. In vielen Fällen sind die Ermittlungen noch nicht abgeschlossen.
03.04.2021 09:11:56 [Amerika 21]
Verhandlungen laufen: Argentinien hofft auf längere Fristen von IWF
Die Regierung von Argentinien versucht weiterhin mit dem Internationalen Währungsfonds (IWF) eine Fristverlängerung zur Rückzahlung der immensen Schulden auszuhandeln.

Präsident Alberto Fernández erklärte, je länger der gewährte Zeitraum sei, desto "freundlicher" für sein Land. Es gehe darum, eine "nachhaltige Übereinkunft" zu erzielen. Er nannte die ursprünglich festgeschriebenen Rückzahlungen bei den momentanen Fristen für die kommenden zwei Jahre (2022: 18 Milliarden US-Dollar, 2023: 19 Milliarden US-Dollar) "unbezahlbar". Fernández forderte zudem seinen Amtsvorgänger Mauricio Macri (2015-2019) auf, sich für die von ihm zu verantwortende Kreditaufnahme beim IWF zu entschuldigen.

03.04.2021 15:09:28 [KenFM]
Geisterschiff im Nadelöhr
Containerschiff Ever Given im Wüstensand: Der zentralisierte Welthandel ist extrem verletzlich. Endlich gab es mal wieder ein ganz anschauliches Ereignis im Nachrichtendschungel zu bestaunen. Anstelle der garstigen Corona-Viren, die man nicht einmal sehen kann, nun also ein spektakulärer Unfall, den man sogar aus dem Weltall orten konnte.

Ein Containerfrachtschiff von gigantischen Ausmaßen hatte sich in den gefluteten Wüstensand des Suezkanals gefressen. Es kommt gar nicht so selten vor, dass im Suezkanal Schiffe auf Grund gehen. 2018 brachte zudem ein Motorschaden ein Containerschiff ganz plötzlich zum Stehen.

03.04.2021 15:24:59 [Telepolis]
Obszöne Dividenden
Das ist selbst manchem bürgerlichen Parteigänger zu viel. Mitten in der Pandemie, nach Kaufprämien für Lkw und E-Autos sowie über 700-Millionen-Euro-Hilfen in Form von Kurzarbeitergeld schüttet Daimler reichlich Dividende aus. 1,35 Euro pro Aktie gibt es, 50 Prozent mehr als im Vorjahr, berichtet das Handelsblatt. Insgesamt fließen 1,4 Milliarden Euro in die Kassen der Aktionäre.

Selbst aus den Reihen der CDU wird da eine "gewisse Sensibilität" angemahnt. Eine Meinungsumfrage im Auftrag der Automobilwoche ergab eine hohe Ablehnung in der Bevölkerung.

03.04.2021 17:27:54 [Telepolis]
Nur "German Angst" vor der Inflation?
Es ist eine Konstante bei Jens Weidmann, vor einer steigenden Inflation zu warnen. Es ist auch eine Konstante, dass dessen Warnungen in deutschen Zeitungen aufgegriffen und gerne auch zugespitzt werden. "Bundesbank-Präsident Weidmann warnt vor der Inflation", titelte zum Beispiel die Frankfurter Allgemeine Zeitung aktuell angesichts einer Weidmann-Rede zum virtuellen Clubabend des Internationalen Clubs Frankfurter Wirtschaftsjournalisten e.V.. Dort breitete er seine Inflationsängste erneut aus.

Weidmann sprach davon, dass nach den jüngsten Schätzungen der Europäischen Zentralbank (EZB) die Inflation im Euroraum in diesem Jahr "deutlich zulegen" werde.

03.04.2021 18:37:38 [Start-Trading]
Goldpreis: Neue Kaufwelle beginnt
Um den Goldpreis ist es etwas still geworden. Schnell gibt es schon die ersten Abgesänge auf das gelbe Edelmetall. Dabei steht der Goldpreis gut da, wenn man sich das längerfristige Chartbild ansieht. Im Moment sind Bitcoin und Aktien einfach deutlich präsenter und das lässt Gold verblassen. An der inneren Stärke ändert das nichts. Schon in Kürze sollte eine neue Kaufwelle beginnen, die den Goldpreis auf ein neues Allzeithoch heben wird. Sagen wir, wie es ist. Bitcoin stielt dem Goldpreis die Show. Die enormen Kurszuwächse beim sogenannten digitalen Gold sind beispiellos. Soviel Geld fließt in Bitcoin und in den Kryptomarkt im Allgemeinen.
04.04.2021 06:52:15 [Ökonomenstimme]
Ökonomische Offenheit: Die Vermessung der Globalisierung
Die zunehmende internationale Integration in den Bereichen Handel und Finanzwirtschaft ist das zentrale Merkmal der Globalisierung, die sich auf das Leben von Milliarden von Menschen rund um den Globus auswirkt.

Die sozioökonomischen Auswirkungen der wirtschaftlichen Globalisierung sind seit Jahrzehnten Gegenstand heftiger wissenschaftlicher und politischer Debatten, und werden es auch in absehbarer Zukunft bleiben. Sozial- und Wirtschaftswissenschafter haben dazu ein breites Spektrum von Fragen untersucht, darunter etwa: Wie wirkt sich die grenzüberschreitende Verlagerung von Kapital und Arbeitsplätzen auf die Besteuerung und die Ausgabenentscheidungen nationaler Regierungen aus?

04.04.2021 09:57:25 [Telepolis]
Mehr als Elendsverwaltung?
Erlebt Amerika derzeit einen Linksruck, der das politische und soziale Erbe des Neoliberalismus in dessen Ursprungsland revidiert? Deutschlands Qualitätspresse scheint jedenfalls dieser Ansicht zu sein. Der "Spiegel" präsentierte den neuen US-Präsident schon im Februar als "Genosse Biden", der seinem Land "im Eilverfahren einen Linksschwenk" verpasse.

Die "Tagesschau" wollte Ende März gar eine "Biden-Revolution" in den Vereinigten Staaten ausmachen. Der demokratische Staatschef wolle einen "totalen Paradigmenwechsel", bei dem das vom neoliberalen Präsidenten Ronald Reagan geprägte Wirtschaftssystem und Gesellschaftsbild "vom Kopf auf die Füße" gestellt werden solle.

04.04.2021 11:23:52 [RT DE]
Der Suez-Stau könnte die Handelsschifffahrt nachhaltig verändern
Angesichts der jüngsten Ereignisse im Suezkanal wurde der Bedarf an alternativen internationalen Schifffahrtsrouten überdeutlich. China und Russland verfügen bereits über konkrete Pläne und sind hiermit bestens positioniert, um daraus Gewinn zu ziehen. Der Suezkanal, diese strategisch wichtige Wasserstraße, beherrschte eine Woche lang die Schlagzeilen, nachdem die Ever Given, eines der größten Containerschiffe der Welt, am südlichen Ende des Kanals in Sand und Schlamm auf Grund gelaufen war. Das Schiff blockierte über mehrere Tage hinweg den Kanal und brachte den darauf angewiesenen Schiffsverkehr zum Erliegen.
04.04.2021 11:46:00 [Brave New Europe]
How Our Intellectuals Help the Rich
Since I came to Washington in 1992, I have been working alongside friends in the policy community, labor movement, and community organizations in fighting against a series of trade pacts. NAFTA was the immediate issue in 1992, but a couple of years later we had the Uruguay Round of the GATT that created the WTO. At the end of the Clinton administration, we had China’s admission to the WTO and then various other smaller pacts.

Those of us who opposed these deals (which were not really about free trade), argued that they would put downward pressure on the wages of manufacturing workers, by putting these workers in direct competition with low-paid workers in the developing world.

04.04.2021 13:20:42 [Telepolis]
Deglobalisierung
Begeisterte Befürworter der Globalisierung erlebten schon einmal bessere Zeiten. In einer Einschätzung der Commerzbank heißt es alarmistisch: "Der Welthandel zerfällt in regionale Blöcke." Protektionismus ist weit verbreitet. Nicht nur die bekannten Instrumente (z. B. Zölle) finden Anwendung. Die Denkfabrik Eurasien-Group spricht von einem "kalten Technologiekrieg". Die USA blockieren den Zugang von Huawai zum US-Markt und "reglementieren den Verkauf von High-Tech-Gütern ans Ausland. So brauchen Unternehmen wie Microsoft inzwischen staatliche Lizenzen, um Software an China zu verkaufen. 'Technologische Vorherrschaft', so US-Vizepräsident Mike Pence, ist eine Bedingung unserer nationalen Sicherheit."
04.04.2021 15:30:42 [Preußische Allgemeine Zeitung]
Die Politik der grenzenlosen Verschuldung gerät an ihr Ende
In einem Eilentscheid stoppt das Bundesverfassungsgericht vorerst die Pläne für den EU-Corona-Fonds. Doch die Politik hält unverändert daran fest. Mit ihrem erfolgreichen Eilantrag beim Bundesverfassungsgericht hat eine Gruppe von Klägern um den Ökonomen und AfD-Mitbegründer Bernd Lucke den sogenannten Corona-Wiederaufbaufonds der EU – vorerst – gestoppt. Dabei geht es keineswegs allein um die unfassbare Summe von 750 Milliarden Euro, von der Deutschland den Löwenanteil verbürgen soll. Es geht zudem um den endgültigen Einstieg in die europäische Schulden- und Transferunion, die es laut Maastrichter Vertrag nie geben sollte.
04.04.2021 15:33:20 [Neues Deutschland]
Ölmultis schrumpfen den Ölsektor
In den letzten zehn Jahren wurden 236 Milliarden Dollar zurückgezogen - zum Wohl der Aktionäre. Die sogenannte Divestment-Bewegung fordert von institutionellen Anlegern, ihre Beteiligungen an Firmen abzustoßen, die ihr Geld mit den fossilen Brennstoffen Kohle, Öl oder Gas verdienen. Dadurch sollen die Kapitalkosten für die Unternehmen nach oben getrieben werden - ein kapitalistischer Anreiz, sich aus klimaschädlichen Geschäften zurückzuziehen. Aktuell haben mehr als 1300 Großanleger versprochen, ihr Geld aus der Fossilindustrie zurückzuziehen. Diese Investoren verwalten immerhin 14,5 Billionen Dollar. Damit rückt ein »sozialer Kipppunkt« in Reichweite, denn die 500 größten Investmentfirmen verwalteten zuletzt rund 100 Billionen Dollar.
05.04.2021 06:46:34 [Ökonomenstimme]
Es war einmal ein Schuldendrama
Die Modern Monetary Theory (MMT) malt eine fantastische Welt. Das Narrativ passt hervorragend in eine Welt der einfachen Lösungen für komplexe Probleme. Viele traditionelle Ökonomen stellen fest, dass ihre Geschichte mit der Inflation, die über kurz oder lang kommt, irgendwie – nach bald 10 Jahren ewiger Wiederholungen – nicht mehr verfängt.

Wir leben in einer Zeit der einfachen Lösungen für komplexe Probleme. Ich erlaube mir deswegen mit einem einfachen Schuldenmodell zu beginnen: Ein Unternehmer, der seine Ausgaben bei immer demselben Gläubiger finanziert (vergessen wir bitte nicht, dass der Gläubiger so heisst, weil er glaubt, dass er sein Geld irgendeinmal wiedersieht).

05.04.2021 09:44:56 [Tichys Einblick]
Der Marktausblick: Genau hinsehen in der Rally
Ein bislang völlig unbekannter Hedgefondsmanager hat vergangene Woche Credit Suisse und Nomura, riesigen, globalen Bankkonzernen herbe Verluste eingebrockt. Je mehr über Bill Hwang und seine Firma Archegos ­Capital Management bekannt wird, desto mehr zeigt sich jedoch, dass hier zugunsten fetter Profite wohl ­einige Warnzeichen übersehen wurden. Hwang, ein Schüler des legendären Hedgefonds-Titans Julian Robertson von Tiger Management, war 2012 von der US-Börsenaufsicht SEC wegen Insiderhandel und Kursmanipulation angeklagt worden. Es gab ­einen Vergleich, bei dem Hwang zustimmte, nicht mehr in der Anlageberatung zu arbeiten.
05.04.2021 14:19:00 [N-TV]
Daimler könnte Hilfe
In der Krise erst Hilfe vom Staat in Millionenhöhe annehmen und dann für denselben Zeitraum hohe Dividenden an die Aktionäre ausschütten: Das ist nach Ansicht der Organisation Finanzwende nicht nur moralisch verwerflich. Kampagnen-Chefin Lena Blanken erklärt, warum sie das auch für betriebswirtschaftlich falsch hält.

NTV.de: Sie wollen heute anlässlich der Hauptversammlung bei Daimler dagegen demonstrieren, dass der Konzern, der in der Corona-Krise unter anderem in der Form von Kurzarbeitergeld von staatlicher Hilfe profitierte, eine Dividende ausschüttet. Ist das ein generelles Phänomen, dass Staatshilfe indirekt an die Aktionäre fließt, oder ist Daimler ein Einzelfall?

05.04.2021 15:41:27 [Start-Trading]
DAX-Ausblick: Die Hoffnung auf Wachstum
An der Börse ist die Coronakrise ein Segen gewesen. Der Kurseinbruch im Frühjahr 2020 hat zu einer außergewöhnlichen Kaufgelegenheit geführt. Seitdem geht es rauf mit den Kursen. Und obwohl die Krise keinesfalls ausgestanden ist, sind de Anleger viel weiter. Sie hoffen auf einen spendierfreudigen Staat, der die Konjunktur anschiebt, auf Konsumenten, die ihre ausgebliebenen Ausgaben nachholen werden. Sie hoffen auf eine starke Wachstumsphase und kaufen schon heute ihre Aktien. Die Coronakrise hat die Welt verändert. Die Anleger jedoch setzen die alten Maßstäbe an, um die Zukunft zu antizipieren.
05.04.2021 15:49:27 [Sozialismus Aktuell]
Erratische Politik des türkischen Präsidenten
Die Absetzung von Notenbankchef Naci Ağbal und der Umbau der Kreditpolitik durch Präsident Recep Tayyip Erdoğan belastet die türkische Wirtschaft schwer – vor allem die Währung.

Der chronische Wertverfall der Lira bewirkt zum einen anhaltende Tendenz zur Erhöhung des Lebensunterhalts der breiten Bevölkerung, deren Einkommen hinter den Preissteigerungen zurückblieben. Auf der anderen Seite werden für Unternehmen die Tilgungen für die Fremdwährungskredite schwieriger. Die Auslandsschulden belaufen sich auf umgerechnet knapp 440 Mrd. US-$ (davon entfallen ein Drittel auf Haushalte und Unternehmen) – und davon nahezu 90% in US-$ oder Euro.

05.04.2021 18:43:35 [Ossietzky]
Wirtschaftsverbrechen
Wirtschaftskriminalität ist allgegenwärtig und verursacht größere Schäden als alle übrigen Verbrechensarten – außer vielleicht Kriegen. Experten gehen davon aus, dass die Zahl der unentdeckt bleibenden Delikte im Bereich der Wirtschaft besonders hoch ist. Erkennbar ist sie nur an den Symptomen der wirtschaftlichen Dauerkrise.

Doch nach öffentlicher und veröffentlichter Meinung sind es keineswegs die profitmaximierenden Herren in Nadelstreifen, die mit der »Tatwaffe Unternehmen« die innere Sicherheit der Staaten und Staatengemeinschaften gefährden. Gefährlich sind – sagen die Ordnungspolitiker, und viele glauben es nur allzu gern – die Ausländer, Asylsuchenden, die illegalen Zuwanderer und Schwarzarbeiter.

06.04.2021 07:01:24 [N-TV]
Briten verspotten deutsche Finanzaufsicht
Im Skandal um die Wirecard-Pleite hat sich die Bundesanstalt für Finanzdienstleistungsaufsicht (Bafin) wahrlich nicht mit Ruhm bekleckert - und muss deshalb viel Kritik einstecken. Die "Financial Times" (FT) legt heute nach: "Deutschlands Finanzaufsichtsbehörde gleicht eher einem gealterten Zwergspitz als einem dynamischen Rottweiler", heißt es in einem Kommentar. "Der riesige Wirecard-Betrug hat die Bafin als zahnlosen Schoßhund entlarvt. Ihre Inkompetenz hallt über Deutschlands Grenzen hinaus nach." Nicht viel besser sei es ihr im Skandal um Greensill Capital und deren Bremer Bank gegangen.
06.04.2021 09:21:03 [Der Freitag]
Mobilität: Der Osten elektrisiert
Die Transformation der Autoindustrie nimmt Fahrt auf, endlich stürmen auch VW und die anderen Tesla nach. Der Schauplatz der Innovationen: Ostdeutschland. Blühende Landschaften im Osten versprach Helmut Kohl vor 30 Jahren. Das Ergebnis ist bekannt. Derzeit sieht es aber so aus, als könnte – Ironie der Geschichte – Kohls Versprechen 30 Jahre später doch noch eingelöst werden: Die Elektromobilität blüht im Osten Deutschlands. Nicht nur baut Tesla in Grünheide bei Berlin das größte Werk für E-Autos in Europa, Ostdeutschland insgesamt entwickelt sich zum europäischen Schwerpunkt beim Elektroantrieb.
06.04.2021 14:53:33 [Telepolis]
Wie der Brexit den Handel behindert
Obwohl der Brexit jetzt in letzter Minute doch nicht ungeregelt und chaotisch erfolgte, sind viele Details noch immer nicht abschließend geklärt und selbst da, wo die Situation geregelt erscheint, müssen die Marktteilnehmer kontinuierlich darauf achten, ob sich die bestehenden Vorschriften inhaltlich verändern.

Kann man sich innerhalb der EU darauf verlassen, dass einschlägige Verordnungen im gesamten Gebiet der EU gelten, muss jetzt kontinuierlich verfolgt werden, was sich in den inzwischen getrennten Wirtschaftsräumen jeweils ändert.

06.04.2021 14:56:37 [Junge Welt]
Devisen: Moskau schützt den Rubel
Die Entscheidung der russischen Zentralbank (ZBR), den Leitzins um 25 Basispunkte auf 4,5 Prozent anzuheben, fiel schon am 19. März. Es ist die erste Leitzinserhöhung seit 2018, und sie markiert eine Trendwende, nachdem die Notenbank im vergangenen Sommer unter dem Eindruck der Pandemiekrise den Leitzins auf ein Rekordtief von 4,25 Prozent abgesenkt hatte. In ihrem Statement zu der Entscheidung schloss die Zentralbank weitere Zinserhöhungen im Laufe des Jahres nicht aus; ihr Ziel einer »neutralen Geldpolitik« impliziert Zinsniveaus bis knapp unter sechs Prozent – es ist also noch Luft nach oben.
07.04.2021 07:00:07 [Brave New Europe]
Draghi isn’t fighting poverty — he’s making it worse
Mario Draghi practising the same clientelism as his predecessors. Whilst the 32 billion appropriation for the tax amnesty had been “found” by Giuseppe Conte, three months after the last Ristori Decree (a package of economic support measures, tailored for the businesses most affected by the restrictions recently imposed to deal with the worsening of the Covid-19 health emergency), the ‘government of the best’, well behind schedule, presented its “Significant, very substantial response to poverty”. Draghi was initially asked by Forza Italia and Lega, to indiscriminately cancel tax liabilities that should have been paid to the Treasury in the years 2000-2015.
07.04.2021 13:18:11 [Telepolis]
Neue faule Kredite und neue Bad Banks?
"Austro-Banken drohen faule Kredite in Milliardenhöhe", titelt die "Tiroler Tageszeitung" heute. Es ist das erste Ergebnis einer Suchanfrage über "faule Kredite". Das Problem ist wieder einmal nicht auf Österreich beschränkt, sondern kommt allgemein erneut auf uns zu. Auch im "Handelsblatt" wird auf "wachsende Kreditausfallrisiken" hingewiesen. Demnach drohen die größten Ausfälle bei den Banken ab 2022, weil sich die Folgen der Pandemie "erst nach und nach in den Bilanzen" niederschlage. Andere Zeitgenossen sehen einen "neuen Zyklus für notleidende Kredite in Europa" am Horizont aufkommen, worauf sich die Banken vorbereiten sollten.
07.04.2021 14:51:36 [RT DE]
Vor 88 Jahren verbot Franklin D. Roosevelt Goldbesitz in den USA
Am 5. April 1933 unterzeichnete US-Präsident Franklin D. Roosevelt kaum vier Wochen nach Amtsantritt die Executive Order 6102, die "das Horten von Goldmünzen, Goldbarren und Goldzertifikaten innerhalb der kontinentalen Vereinigten Staaten verbietet." Könnte Bitcoin heute das gleiche Schicksal wie damals Gold ereilen? Der Erlass war eine Reaktion in einem ganzen Bündel von Maßnahmen seines "New Deal" als Folge auf die Große Depression, die letztlich zur Eskalation der Finanzkrise geführt hatte. Zwar folgte später im selben Jahr noch eine Resolution des US-Kongresses, um die Gesetzgebung rückwirkend zu unterstützen; dennoch war es die entschlossene autokratische Führung von Roosevelt (FDR), die den Weg für diese beispiellosen Maßnahmen ebnete.
07.04.2021 16:19:15 [Buchkomplizen]
Kommt ein Ende des Steuerdumpings?
Die ehemalige Chefin der US-Notenbank (FED) und die neue Finanzministerin unter der Regierung Joe Biden fordert einen Mindestsatz zur Besteuerung von Unternehmen weltweit. „Gemeinsam können wir mit einer globalen Mindeststeuer sicherstellen, dass die Weltwirtschaft gedeiht auf der Basis fairer Wettbewerbsbedingungen mit der Besteuerung multinationaler Konzerne“, erklärte Janet Yellen in einer Rede vor dem Rat für globale Angelegenheiten in Chicago. Ihr schwebt dabei ein Steuersatz von 21 Prozent vor.

Die USA drängen bereits im Rahmen der Organisation für wirtschaftliche Zusammenarbeit und Entwicklung auf ein multilaterales Abkommen für eine Digitalsteuer.

07.04.2021 18:37:01 [Start-Trading]
DAX: Die Illusion der Stärke
Anleger mögen es unkompliziert. Steigt der DAX, dann ist ihre Welt in Ordnung. Dieses einfache Denkmuster wird medial gefördert, weil steigende Börsenkurse mit wirtschaftlicher Stärke zusammengebracht werden. Diese Schlussfolgerung ist in den meisten Fällen falsch und dennoch fühlen sich Aktionäre in ihren Positionen sicher. Dass die Börsen auf Allzeithoch notieren, ist nicht der inneren Stärke der Unternehmen geschuldet. Dennoch lassen sich die Marktteilnehmer mitreißen. In den letzten Tagen wird vermehrt von einer starken US-Konjunktur gesprochen. Dies animiert die Anleger mehr Aktien zu kaufen. Es heißt, die US-Wirtschaft würde „Gas geben“.
08.04.2021 07:04:42 [Blog der Republik]
Brexit: Schuss ins eigene Knie
Englands Premierminister Johnson verkündete das neue Paradies, in dem sich seine Landsleute nach dem Brexit wiederfinden würden. Doch mehr und mehr wird klar, dass sich die Engländer auf eine Höllenfahrt begeben mussten. In vielen Bereichen herrscht ein totales Chaos, in manchen droht der Kollaps. Die Britische Handelskammer traf den Nagel auf den Kopf, als sie gerade feststellte: Der Brexit ist wie eine Zwiebel. Je mehr Schichten man abpellt, um so mehr muss man weinen.“ Das Desaster droht in der nächsten Zeit noch größer zu werden als bisher schon.
Großbritanniens Unternehmen verzweifeln an den Zollformalitäten inzwischen genauso wie ihre deutschen Geschäftspartner.

08.04.2021 13:13:14 [Telepolis]
G20-Finanzminister wollen
Janet Yellen, ehemalige Chefin der US-Notenbank (FED) und neue Finanzministerin unter der Regierung von Joe Biden, hatte vor ein paar Tagen einen Mindestsatz zur Besteuerung von Unternehmen weltweit gefordert.

Offensichtlich ist sie damit bei den aktuellen Beratungen der Finanzminister der zwanzig führenden Wirtschaftsnationen (G20) auf offene Ohren gestoßen. Die Minister berieten sich am Rande der Online-Frühjahrstagung des Internationalen Währungsfonds (IWF) auch über die geforderte Mindeststeuer.

Yellen setzte sie mit 21 Prozent auf die Tagesordnung.

08.04.2021 18:53:31 [Junge Welt]
Wettlauf bei Erdgasleitung: Polens letzter Versuch
Die Bauarbeiten an der Ostseepipeline Nord Stream 2 sind seit einigen Wochen Störversuchen von polnischer Seite ausgesetzt. Dies beklagte in den letzten Märztagen die für den Bau zuständige Tochtergesellschaft des russischen Gasprom-Konzerns. Russische Agenturen melden, dass sich bereits seit Ende Februar Fälle mehrten, in denen polnische Kriegsschiffe und Fischerboote in der Sicherheitszone rund um die Position des Verlegeschiffs »Fortuna« auftauchten. Genannt wurde insbesondere ein Schiff mit der taktischen Nummer 823, das in internationalen Schiffahrtsregistern als der in Swinoujscie stationierte Minenleger »Krakow« verzeichnet sei. Ende März habe sich sogar ein nicht identifiziertes U-Boot unweit der »Fortuna« gezeigt.
09.04.2021 09:17:15 [Brave New Europe]
2008: ban bailout. 2021: planet bail out
The COVID-19 pandemic is not a random event. It is a symptom of a global economic system that is destroying the living planet. The COVID-19 pandemic has been a nightmare for all of us. As vaccines are deployed across the world, many hope we’ll soon be able to return to our previous lives. But before we rush to resume ‘business as usual’, we should pause to consider where COVID came from.

Like many infectious diseases, COVID-19 has its origins in the encroachment of human activity into the natural world.

09.04.2021 13:19:05 [RT DE]
BDI verreißt Programmentwurf der Grünen noch bevor der beschlossen wird
Die Grünen hatten Mitte März den Entwurf für ihr Wahlprogramm vorgestellt und wollen es auf ihrem Parteitag im Juni beschließen.

Aus Sicht des Bundesverbandes der Deutschen Industrie (BDI) offenbart der Entwurf ein ausgeprägt dirigistisches Staatsverständnis und eine sehr eingeengte Perspektive auf ein Staatsziel Klimaschutz. Der Verband kritisiert unter anderem die Forderung nach höheren CO2-Preisen, Vorgaben zur Nutzung von Wasserstoff und Klimaverträglichkeitsprüfungen. Höhere Steuern für Unternehmen minderten den finanziellen Spielraum für Investitionen auch in klimafreundliche Technologien.

09.04.2021 14:48:55 [NachDenkSeiten]
„Der Staat braucht das Geld der Reichen nicht“
Von ihren Anhängern wird die Modern Monetary Theory (MMT) gerne als das neue wirtschaftspolitische Wundermittel angepriesen. Man müsse nur die Staatsausgaben richtig justieren und schon sind alle Probleme gelöst, von der Vollbeschäftigung bis zur Preisniveaustabilität. Der Ökonom und Betriebswirt Maurice Höfgen hat in seinem Buch „Mythos Geldknappheit“ eine progressive Reformagenda auf Basis ebenjener MMT skizziert. Höfgen ist zwar wissenschaftlicher Mitarbeiter bei der Partei Die Linke im Bundestag, doch mit vielen Vorschlägen liegt er konträr zu linken Positionen. Dazu haben ihn die „NachDenkSeiten“ befragt.
09.04.2021 14:56:49 [Brave New Europe]
Biden’s tax plan: tackling class warfare of US elite
The Biden tax plan is radically different from anything we have seen from the US for a number of years. The plan could be summarised as an attack in a single problem. As I have, for longer than most people, been arguing, tax havens have been used to mount an assault on the right of states to tax, and even if the damage has been better contained from about 2012 on it has not been reversed. When 70% of US foreign earnings are in tax havens there is something seriously wrong with corporate behaviour, which can only be explained by a desire to undermine the US tax system.
09.04.2021 15:54:41 [Junge Welt]
Erdölproduktion: Versuchsballon des Kartells
Das von Saudi-Arabien und Russland dominierte Kartell »OPEC plus« hat am 1. April beschlossen, die Erdölförderung bis zum Juli in drei Monatsstufen um insgesamt 2,15 Millionen Barrel pro Tag (barrel per day, bpd) zu steigern. Nach der Bekanntgabe stiegen in den ersten Stunden die Ölpreise. Nach wirtschaftlicher Logik hätte man das Gegenteil erwartet: mehr Angebot bei unveränderter Nachfrage, also sinkende Preise. Hintergrund war jedoch, dass die Entscheidung der 23 Staaten umfassenden Gruppe, die mit Ausnahme der USA die wichtigsten erdölfördernden Länder einschließt, als Zeichen des Vertrauens in eine stabile Erholung der Weltwirtschaft und demzufolge auch als Erwartung einer wachsenden Nachfrage nach Erdöl und Ölprodukten interpretiert wurde.
09.04.2021 18:47:29 [Tichys Einblick]
Die EZB finanziert Europas Staatsdefizite
Seit der Finanzkrise 2007/2008 sind die großen Notenbanken der Welt, vor allem die amerikanische Federal Reserve (Fed) und die europäische Zentralbank (EZB), nicht mehr aus ihrem ultralockeren Krisenmodus aus Nullzinspolitik und üppigen Staatsanleihekäufen ausgestiegen. Als Regierungen in aller Welt im letzten Jahr mit Flächenstilllegungen des Wirtschafts- und Soziallebens auf eine Pandemie zu reagieren begannen und damit Konjunktureinbrüche auslösten, hatten die Notenbanken ihr geldpolitisches Pulver praktisch verschossen. Deshalb verschulden sich in diesen Zeiten die Regierungen in einem Ausmaß, das in Friedenszeiten keine Beispiele kennt.
10.04.2021 08:52:00 [Amerika 21]
Argentinien gibt nach: Treffen des Mercosur für Pläne der Flexibilisierung angesetzt
Argentinien hat ein Sondertreffen der Wirtschaftsgemeinschaft Mercosur angesetzt, um die kürzlich von Uruguay und Brasilien vorgeschlagene Flexibilisierung des Bündnisses zu besprechen. Am 22. April werden auf Drängen Uruguays die Außenminister im Rat des Gemeinsamen Marktes (CMC) zusammentreffen, um mögliche Maßnahmen zu diskutieren. Bereits gestern und heute kam es dafür zu vorbereitenden Treffen. Beim Gipfel zum 30. Jahrestag des Mercosur Ende März hatte die Regierung des argentinischen Präsidenten Alberto Fernández auf den Vorstoß einer Flexibilisierung zunächst mit großer Skepsis reagiert.
10.04.2021 11:34:16 [Brave New Europe]
Financial fiction: the new ones
Finance capital is ever-ingenious in inventing new ways of speculation and swindles. In the past we have had the dot.com boom when the stock prices of many internet start-ups exploded upwards, only to crash when the profits of these companies did not materialise and the cost of borrowing to speculate rose. That was in 2000 and followed by a mild recession in 2001.

Then we had the huge credit boom in house prices, mortgages and the securitised mortgage packages and their derivatives that fuelled a huge property and stock market boom that collapsed into the Global Financial Crash of 2008 and the subsequent Great Recession.

10.04.2021 17:15:22 [Junge Welt]
Standorterhalt: Erpresserische Methoden
Bis Mittwoch abend konnten die Beschäftigten des Lastwagenbauers MAN am oberösterreichischen Standort Steyr über die Zukunft des Werks abstimmen. Gefragt wurde, ob der Standort vom Automobilmanager Siegfried Wolf übernommen werden soll. Am Donnerstag hat der Betriebsrat verkündet, dass sich rund 64 Prozent gegen die Übernahme entschieden hätten. An der Abstimmung beteiligt haben sich demnach 94 Prozent der rund 2.300 Beschäftigten des Werks. Nun ist unklar, wie es weitergeht.

Im Vorfeld der Wahl versuchte die Konzernspitze in München Druck auf die Beschäftigten auszuüben, damit sie der Übernahme zustimmten.

10.04.2021 18:49:37 [Infosperber]
Banken kappen Kredite für umweltschädigende Rohstoff-Riesen
Das Finanzieren von Rohstoffgeschäften wird für Banken zunehmend zum Reputationsrisiko. Einige haben das mittlerweile erkannt.

Im Februar machte die französische Grossbank BNP Paribas eine wichtige Ankündigung: Sie wird künftig keine Unternehmen mehr finanzieren, die mit Rindfleisch und Sojabohnen handeln, die aus Ländereien im Amazonasgebiet stammen, die nach 2008 gerodet wurden. BNP war einst das weltweit wichtigste Institut zur Handelsfinanzierung. Nur wenige Wochen zuvor hatte sich BNP Paribas der Schweizer Grossbank Credit Suisse und dem niederländischen Kreditinstitut ING angeschlossen, um die Vergabe von Krediten an jene Rohstoffhändler einzustellen, die im ecuadorianischen Regenwald gefördertes Erdöl kaufen und verkaufen.

10.04.2021 19:00:38 [Wirtschaftswunder]
Neue Wirtschaftsdoktrin – Beschert uns Joe Biden eine Ära des Wohlstands?

Der neue US-Präsident haut ein Billionenprogramm nach dem nächsten raus. Zu viel, sagen Kritiker. Doch Bidens Plan hat das Potenzial, das desaströse Dogma der Reaganomics endlich abzulösen.

Erst war die Rede von einem Konjunkturpaket über 1,9 Billionen US-Dollar. Jetzt sollen noch einmal gut 2,2 Billionen dazukommen, wie Joe Biden kürzlich verkündet hat – um Amerikas Infrastruktur aufzupeppen. Der dritte Streich folgt wohl in Kürze – dann sollen von der Regierung noch einmal zwischen ein und zwei Billionen mobilisiert werden, um Schulen und Gesundheit zu fördern. Schwindelerregend.

11.04.2021 07:13:41 [KenFM]
Die Impfkampagne – Follow the Money
Die Welt erlebt zurzeit die erste globale Impfaktion ihrer Geschichte. Im Gegensatz zu früher werden diesmal Impfstoffe eingesetzt, die innerhalb von kaum mehr als einem Jahr entwickelt wurden und deshalb nicht auf Langzeitnebenwirkungen getestet werden konnten. Es ist daher unmöglich, eine auf Erfahrungswerten basierende Entscheidung für oder gegen eine Impfung zu treffen.

Umso wichtiger ist es, sich darüber klar zu werden, dass es bei der aktuellen Massenimpfung nicht nur um Krankheitsvorbeugung, sondern auch um sehr viel Geld geht. Es empfiehlt sich also, einen Blick auf die materiellen Interessen zu werfen, die die gegenwärtige Kampagne im Hintergrund antreiben.

11.04.2021 11:34:09 [Klimareporter]
IWF-Chefin fordert Klimafaktor bei der globalen Schuldenpolitik
IWF-Chefin Kristalina Georgiewa hat die reichen Länder aufgefordert, die Folgen des Klimawandels beim Eintreiben von Staatsschulden zu berücksichtigen. Zwar sei das Einkommensniveau eines Landes die wichtigste Messlatte.

Aber: "Es gibt noch andere Quellen der Verletzlichkeit, zum Beispiel ein hohes Risiko für Klimaschocks", sagte sie auf der laufenden Frühjahrstagung von Internationalem Währungsfonds (IWF) und Weltbank.

"Deshalb sollte die Staatengemeinschaft diese anderen Faktoren einbeziehen, wenn es darum geht, Entwicklungsländer zu unterstützen", so Georgiewa.

11.04.2021 15:13:08 [Fluter]
Kleine Börsenkunde
Was die Kurssprünge der Gamestop-Aktie bedeuten und warum sie die Finanzwelt beunruhigen. Ein renditestarkes FAQ: Was ist die Gamestop-Saga? Kleinanleger haben Hedgefonds – milliardenschwere Investmentfonds, die mit spekulativen Geldanlagen viel Gewinn machen wollen – an der Wall Street Anfang des Jahres Milliardenverluste beschert. Und zwar mit voller Absicht. Im Mittelpunkt der Ereignisse steht die Aktie des US-Videospielehändlers Gamestop, die schon seit einiger Zeit wenig wert war. Auf sie haben Finanzprofis eine Wette abgeschlossen: nämlich dass ihr Kurs weiter sinkt.
11.04.2021 16:43:54 [Trading Treff]
Die neue Trading-Woche
Der Schwung aus der Osterwoche wird hier noch einmal dargestellt. Er endete in einer Konsolidierung. Neue Szenarien stehen damit für die nun startende Trading-Woche an. Nach dem neuen Rekordhoch direkt am Dienstag, dem ersten Handelstag nach Ostern, gab es auf der Oberseite keine weiteren Rekorde im DAX zu verzeichnen. Damit steht seit vier Handelstagen die 15.311 als Messlatte im Markt auf der Kurstafel. Es folgte eine Konsolidierung, die bereits am Mittwoch nach dem Bruch des starken Aufwärtstrends eingeleitet wurde. Ohne weiteres Momentum klang die Handelswoche aus und pendelte sich immer wieder im Bereich der 15.200 Punkte ein.
11.04.2021 16:44:56 [Start-Trading]
DAX-Ausblick: Rallye auf den letzten Metern
Geht es nach den Marktteilnehmern, dann kann es für die Börsen nicht besser laufen. Der DAX notiert auf Allzeithoch, die Stimmung ist am Zenit. Die Anleger hoffen auf einen Boom der Wirtschaft, sobald alle Coronafesseln gelöst werden. Diese Erwartungshaltung passt gar nicht zu der Entwicklung, dass die Bundesregierung das Infektionsschutzgesetz straffen möchte, um härtere Maßnahmen durchzusetzen. Noch läuft die Börsenrallye, doch sie befindet sich auf den letzten Metern. Das aktuelle Börsenumfeld zeigt eine Blasenentwicklung. Die unbändige Gier nach Aktien, die Angst eine Kursrallye zu verpassen, sie greift immer mehr um sich.
11.04.2021 17:06:42 [BIP-Jetzt-Blog]
Israel hält das besetzte Palästina im ökonomischen Würgegriff
Die palästinensische Wirtschaft befindet sich in schlechtem Zustand, und die Covid19 -Krise trifft sie schlimmer als die meisten Länder der Welt. Das Fehlen einer palästinensischen Währung, ein erhebliches Handelsungleichgewicht mit Israel und eine hohe Abhängigkeit von unbeständiger internationaler Hilfe haben die palästinensischen Regierungen der Instrumente beraubt, die notwendig sind, um die Bevölkerung in Krisenzeiten zu unterstützen. Das anhaltende Handelsdefizit der palästinensischen Wirtschaft, aufrecht erhalten durch internationale Hilfe, dient der israelischen Wirtschaft als Devisenquelle, faktisch als eine Form des Exports.
11.04.2021 18:52:11 [Lunapark 21]
Fiat-Geld und Bullshit-Bitcoins
Der neue Bitcoin-Hype und Elon Musk

Vor drei Jahren, als der Preis des Bitcoin von über 20.000 auf unter 10.000 Dollar gefallen war, gab ich (in Heft 41) über seine Börsenaussichten eine Leerprognose ab: „Wie er sich in Zukunft entwickeln wird, weiß niemand, denn Bitcoin hat schon manchen Kurseinbruch überstanden…“ Heute (20. Februar) liegt der Kurs über der 50.000-Dollar-Marke. Warum?

Die Erschaffung des Bitcoin war eine Reaktion auf die Finanzkrise 2008/9. Ursprünglich wurde die Kryptowährung von Enthusiasten erschaffen, die das Finanzsystem demokratisch gestalten und damit die Macht der Zentralbanken brechen wollten.

 Topthemen (70)
01.04.2021 07:12:53 [Republik]
Die Lobby, die bei der E-ID die Fäden zieht
Warum sich der Bund früh als Anbieter einer elektronischen Identität aus dem Spiel nahm – und wie die Privatwirtschaft den Gesetzgebungs­prozess beeinflusste: eine Rekonstruktion. «Der Bund kann das nicht» – dieser Gedanke steht hinter dem Gesetz über die elektronische Identität oder kurz E-ID, über das die Schweizer Stimm­bevölkerung am 7. März abstimmt. Nicht der Staat soll seinen Bürgerinnen eine digitale Identität anbieten, die im Internet die Funktion eines amtlichen Ausweises übernimmt, sondern Privat­unternehmen. Es gibt in ganz Europa kein anderes Land, das dies so handhabt. Keines, das nicht eine staatliche E-ID herausgibt.

Wie kam es zu diesem digital­politischen Sonderweg? Wann entschied der Bund, dass er «das nicht kann»?

01.04.2021 09:57:48 [Junge Welt]
WHO-Corona-Bericht: Viren als Kriegstreiber
Vor mehr als hundert Jahren forderte ein aggressiver Erreger 20 bis 50 Millionen Tote. Das Influenzavirus A/H1N1 hatte – direkt nach dem Ersten Weltkrieg – leichtes Spiel. Die Seuche hat als »Spanische Grippe« traurige Berühmtheit erlangt und wird, trotz aller Unterschiede zum Geschehen der Jahre 2020/21, gern als Parallele für die aktuelle Coronapandemie bemüht.

Auch wenn Spanische Grippe und Covid-19 medizinisch schwer vergleichbar sind, eine Gemeinsamkeit gibt es: Weder für das Coronavirus noch für A/H1N1 ist die Herkunft eindeutig geklärt. Die Grippe hatte mit Spanien nichts zu tun, sie firmierte auch unter dem Namen »Flandrisches Fieber« – je nachdem, wo sie in Europa erstmals bemerkt wurde.

01.04.2021 13:24:02 [Zeit Online]
Gewerkschaften in den USA: Dreckig, gefährlich, erniedrigend
Unter den Beschäftigten der amerikanischen Internetkonzerne formiert sich eine neue Gewerkschaftsbewegung. Eine Parkbank in Manhattan ist das Büro von Miguel. Hier nimmt der Fahrradkurier seine Aufträge entgegen. Der 34-Jährige kommt aus Guatemala, aus Angst vor den Einwanderungsbehörden will er seinen Nachnamen nicht nennen. Er ist einer von inzwischen 80.000 Lieferanten, die in New York Mahlzeiten ausliefern. Auftraggeber sind Smartphone-Apps wie DoorDash, GrubHub oder Postmates.

An guten Tagen verdient Miguel bis zu 100 Dollar. An schlechten Tagen wartet der Vater zweier Kinder vergeblich auf das Klingeln seines Smartphones, das einen Auftrag ankündigt.

01.04.2021 13:39:52 [Brave New Europe]
Vaccines: Is Bill Gates the answer?
What is more important for Bill Gates, patent laws or saving millions of lives? Elon Musk seems an unlikely source but he is reported as blogging, “Patents are ‘intellectual property landmines. They stifle innovation, entrench the position of giant corporations and serve only to make lawyers rich rather than to reward actual inventors.” This was in 2014. We are all grateful to inventors, especially those that have pulled off the seemingly miraculous feat of developing a successful vaccine for a coronavirus within a year of the outbreak of a pandemic.
01.04.2021 17:10:13 [WOZ - Die Wochenzeitung]
Vernetzte Bibliotheken: Wer sucht, der findet nichts mehr
Eine neue digitale Plattform verbindet fast 500 wissenschaftliche Bibliotheken der Schweiz. Doch vier Monate nach dem Start sind Mängel noch immer nicht behoben. Die Verantwortlichen hingegen zeigen sich zufrieden. Was haben ein sechsjähriges Kind in Solothurn und ein Professor für Amerikanistik an der Universität Basel gemeinsam? Seit vier Monaten nutzen sie dasselbe Bibliotheksnetzwerk; über die neue Swiss Library Service Platform (SLSP) können sie beide bis zu hundert Medien auf einmal ausleihen.

Das Angebot ist gratis – doch in den Mahngebühren kann sich das rächen.

01.04.2021 19:00:06 [Der Freitag]
Libysche Zentralbank und Moslembruderschaft
Wie ist es möglich ist, dass sich der Direktor der Libyschen Zentralbank (CBL) Sidiq al-Kebir nach zehn Jahren immer noch auf seinem Posten halten kann, obwohl seine Amtszeit von Korruptionsvorwürfen erschüttert und die Finanzierung von Milizen und Extremisten durch die CBL belegt ist? Auch unter der neuen GNU-Übergangsregierung weigert sich al-Kebir, seinen Posten zu verlassen, obwohl die Neubesetzung des Postens vereinbart wurde. Wer ist Sidiq al-Kebir? Geboren wurde er 1951 in Tripolis. Seine kriminellen Energien taten seiner Karriere keinen Abbruch, ganz im Gegenteil.
01.04.2021 19:04:20 [Egon W. Kreutzer]
Schokohasen – Opium fürs coronierte Volk
Zum zweiten Osterfest im Zeichen von Corona könnte man einfach nur sagen: "Vergiss es!" Man kann aber auch fragen: Was unterscheidet dieses Ostern von anderen Ostern und von dem, worauf sich die Feiertage zurückführen lassen. Es sind nicht die eierlegenden Hasen! Soviel ist gewiss. Man kann weiter fragen, ob sich in den letzten 2000 Jahren etwas grundlegend geändert hat - und wird zu der Erkenntnis kommen, dass eine Welt ohne Ketzer vollkommen unvorstellbar ist. Ich bin überzeugt, dass dieser alte gelbe Mann sich unter einer „neuen Welt“ eher das genaue Gegenteil dessen vorgestellt hat, was das von keiner demokratischen Muse geküsste Weltwirtschaftsforum und sein Gründer, Klaus Schwab, mit ihrem Great Reset beabsichtigen.

02.04.2021 07:34:17 [Luftpost]
Welche destruktiven Absichten verfolgt Biden mit seiner Russland-Politik?
Die Biden-Administration betrachtet Russland als das Haupthindernis auf dem Weg zur US-Weltherrschaft. Die neue Biden-Regierung hat vom ersten Tag an klargemacht, dass sie eine feindselige und aggressive Politik gegen die Russische Föderation und deren Präsidenten Wladimir Putin betreiben wird. Diese Politik hat nichts mit irgendwelchen feindlichen Absichten gegenüber dem Westen zu tun, die Russland und Putin unterstellt werden. Sie hat auch nichts mit der absurden Behauptung zu tun, Putin habe den proamerikanischen Dissidenten Alexei Navalny mit dem absolut tödlichen Nervengas Novitschok vergiften lassen. Der unter Biden betriebenen Politik liegt die These von den globalen „Powers That Be“ zugrunde.
02.04.2021 09:46:28 [Abgeordnetenwatch]
Gegen diese Abgeordneten laufen Ermittlungs- oder Gerichtsverfahren
Gegen mindestens neun Abgeordnete im Deutschen Bundestag ist nach Recherchen von abgeordnetenwatch.de ein Gerichts-, ein Ermittlungs- oder ein Disziplinarverfahren anhängig. In gleich mehreren Fällen geht es um den Verdacht der Bestechlichkeit, der Untreue oder um Verstöße gegen das Parteiengesetz. Ein Parlamentarier wurde zu einer fünfstelligen Geldstrafe verurteilt – wegen Beihilfe zur gefährlichen Körperverletzung. Am 4. März rückten Beamte des Bundeskriminalamtes zu einer Durchsuchung in den Deutschen Bundestag aus. Ihr Ziel: Das Büro des CDU-Bundestagsabgeordneten Axel E. Fischer. Bei ihm besteht nach Überzeugung der Generalstaatsanwaltschaft München ein Anfangsverdacht der Bestechlichkeit.


02.04.2021 12:09:20 [Jacobin]
Keine Rettung für das Kino
Der Staat tut derzeit wenig, um das Kinosterben aufzuhalten. Doch mit den Kinos schwindet auch ein Teil der kritischen Öffentlichkeit. JACOBIN hat eine Betreiberin besucht: Das Licht fällt auf die Leinwand. »Scheiß drauf, den Strom und die Lampenabnutzung gönn’ ich mir jetzt«, habe sie sich beim Schauen der Berlinale gesagt, erzählt die Kinobetreiberin Andrea Stosiek. Die Frau mit dem Nasenpiercing und der runden Brille sitzt in einem dunklen Saal, die Reihen um sie herum sind leer, weil das Berliner Filmfestival in diesem Jahr online stattfindet.


02.04.2021 16:42:58 [Telepolis]
Bleib wach Soldat, mach', was wirklich zählt!
Über eine Plakatkampagne des Militärministeriums zu den Ostermärschen. Ein pazifistischer Zwischenruf: Wie seit nunmehr über 60 Jahren wird auch in diesem Jahr in zahlreichen Städten zu den Ostermärschen für den Frieden eingeladen. Das Netzwerk Friedenskooperative informiert in einem Terminkalender über alle leibhaftigen Zusammenkünfte - selbstredend unter rationalen Maßnahmen zum Gesundheitsschutz - sowie über Möglichkeiten, sich am virtuellen Ostermarsch zu beteiligen.

Die CDU/SPD-Regierung ist verantwortlich dafür, dass die Atombombe leider noch immer auch als explizit "deutsches Thema" bei den Ostermärschen zur Sprache kommen muss.

02.04.2021 19:02:50 [Brave New Europe]
We have to consign the era of financial engineering to history
The past week has been interesting in the world of finance.

Greensill Capital collapsed. The provider of what might best be described as unusual forms of supply chain financing to what seem to have been vulnerable companies unable to offer what seem like conventional security for loans, the model ran out of steam despite the support of former Prime Minister David Cameron.

Significant numbers of companies are left vulnerable as a result, from the UK’s third-largest steel manufacturer to banks that had provided Greensill with its funding.

03.04.2021 06:51:20 [Telepolis]
WM 2022 in Katar: größer, teurer, blutiger
Boykott-Diskussion und Fifa-Kriterien: Ein Land, das eine Fußball-WM ausrichten will, muss vor allem in der Lage sein, viel Geld auszugeben. Demokratie ist dabei Nebensache und vielleicht sogar hinderlich. Erinnert sich jemand an den 2. Dezember 2010? Es wäre übertrieben zu sagen, das sei das "Nine Eleven" des internationalen Fußballs gewesen, aber ein riesiger Schock und eine Zäsur war es allemal: In Zürich öffnete Fifa-Präsident Sepp Blatter vor laufenden Kameras ein Blatt Papier, auf dem groß "Qatar" gedruckt stand. Die Entscheidung war gefallen.
03.04.2021 09:28:28 [Brave New Europe]
The failure of the Eurozone in the fight against the pandemic
What has happened, and continues to happen, in Europe and in particular in the euro area, is something strange, incredible and a travesty. Among the unfortunate characteristics of the coronavirus pandemic is its egalitarian nature. It has affected all continents, and especially the most disadvantaged as in the case of many African and South American countries. However, not only were the effects not the same between countries with very different geographical locations in the world but even between the countries of the northern hemisphere that are generally more capable of a reaction being economically well endowed.
03.04.2021 11:16:54 [TAZ]
Waffenembargo in Libyen: Bundeswehr-Panzer für den König
Seit zehn Jahren gilt für das Bürgerkriegsland Libyen ein Waffenembargo der Vereinten Nationen. Nur wenige wissen das besser als Außenminister Heiko Maas (SPD) und seine Mitarbeiter. Bis Ende 2020 leiteten Spitzendiplomaten aus Deutschland sogar das zuständige Komitee des UN-Sicherheitsrats, das sich mit dem Libyen-Embargo beschäftigt. Dort kommen auch immer wieder die vielen Verstöße gegen den Einfuhrbann zur Sprache. Also wissen Maas und seine Leute auch, welche Länder in besonders eklatanter und – so ein UN-Bericht – „unverfrorener Weise“ das Embargo verletzen: die Vereinigten Arabischen Emirate (VAE), die Türkei und Jordanien.

So stand es jedenfalls in einem UN-Expertenbericht zu dem Thema im Dezember 2019.

03.04.2021 11:31:01 [Der Freitag]
Statistisch aufgerüstet
Mit dem „Zwei-Prozent-Ziel“ der NATO versuchen Rüstungsbefürworter Militärausgaben herunterzuspielen. Die Friedensbewegung sollte besser von der Rüstungsquote sprechen. Mitten in der Coronakrise pumpen CDU/CSU und SPD nach NATO-Kriterien rund 53 Milliarden Euro in die Rüstung. Ein Rekord. Allein die Kosten für Neuanschaffungen beim Kriegsgerät sind in den vergangenen vier Jahren um 71 Prozent gestiegen. Wie aber erklärt es sich dann, dass, trotz der Spitzenwerte, immer wieder in der Öffentlichkeit das Argument zu hören ist, Deutschland investiere noch nicht genug in Bomben, Panzer und Raketen?
03.04.2021 15:15:39 [WOZ - Die Wochenzeitung]
Am Ende bist du doch allein: Anarchie und Wildheit im Cyberspace
Da steht Marc Walder.

Aufrecht. Wie immer. Leute wie er sind Steher.

Liegen ist ihnen suspekt, weil – zu weit unten. Daher kommen sie.

Vom Leistungssport. Alle.

Nun steht er da, die CEO-gewordene Verheissung des Kapitalismus: Jeder, der ein weisser Mann aus normalen Schweizer Kleinbürgerverhältnissen und gesund ist, kann es aus eigner Kraft schaffen. Wenn er sich anstrengt. Wenn er Sport macht, statt Joints zu rauchen.

(Notieren: Wenn ich ein Kind kennenlerne, immer zum Gammeln und Lesen raten.)

Marc Walder hat sich durch das Ghetto der Ringier-Journalistenschule über Yellow-Press-Homestorys bis hin zum seriösen, unerschrockenen Tagesjournalismus gearbeitet.

03.04.2021 17:10:38 [Der Freitag]
Jemen: Ungleiche Gegner
Die veränderte Außenpolitik in Washington lässt die Hoffnung auf Frieden gedeihen. Aber die „Koalition der Willigen“ zerfällt. Nach sechs Jahren Krieg sind im Jemen 250.000 Tote und 28,5 Millionen Binnenvertriebene zu beklagen. Alle zehn Minuten stirbt ein Vorschulkind an Unterernährung. Dieses Leid haben nicht zuletzt die vor sechs Jahren begonnenen Bombardierungen durch eine von Saudi-Arabien geführte „Koalition der Willigen“ angerichtet. Kriegsentscheidend sind derartige Luftangriffe freilich nur, falls ihnen genügend Boden-truppen folgen, wie man spätestens seit dem Vietnamkrieg (1965 – 1975) weiß.
04.04.2021 11:20:14 [Anti-Spiegel]
Was ist die „Biden-Doktrin“?
Think Tanks und NGOs sind die Spezialität der USA und des Westens. Für Russland ist das noch Neuland und das Land hat nur wenige solcher Organisationen, die einem unüberschaubaren Netzwerk westlicher Stiftungen gegenüberstehen. Während der Westen in Russland ungezählte politische NGOs unterhält, bekam der Spiegel schon Schnappatmung, als in Berlin eine einzelne russische NGO aktiv geworden ist.

Aber Think Tanks wollen auch die Politik beeinflussen, was sie im Westen sehr erfolgreich tun, man denke nur an die RAND-Corporation, über deren Arbeit ich mehrfach berichtet habe, zum Beispiel in einer 20-teiligen Sonderreihe zu einer einzigen Studie darüber, wie die USA nach Meinung der RAND-Corporation Russland schwächen sollten.

04.04.2021 13:24:45 [M 7]
Wenn das Mittel zum Zweck wird
Mit welchem Motiv gehen Menschen durch die Welt, wenn es ihnen vergönnt ist, über Macht zu verfügen? Was treibt sie an, das zu tun, was sie tun? Die Antworten auf diese Fragen sind vielfältig. Da gibt es, um mit einer positiven Konnotationen zu beginnen, diejenigen, die eine Vision haben und dieser folgen. Sie wollen die Verhältnisse, in denen sie leben, verändern hin zu einer von ihnen vermuteten besseren Welt. Sie nutzen die Möglichkeiten, die ihnen zur Verfügung stehen, um positiv auf die Lebensumstände, die Arbeitsbedingungen, die sozialen Beziehungen einzuwirken. Dabei haben sie darauf zu achten, dass die Mittel, die sie dabei anwenden, mit den Zielen korrespondieren.
04.04.2021 15:19:02 [Infosperber]
NATO: vom Verteidigungsbündnis zum Angriffspakt
Die NATO wurde 1949 als Verteidigungsbündnis gegen die Sowjetunion gegründet. Jetzt will sie auch präventiv angreifen dürfen.

1949, vier Jahre nach dem Ende des Zweiten Weltkrieges, haben die USA, Kanada und zehn westeuropäische Länder die NATO gegründet, die Nordatlantik-Pakt-Organisation. Ihre Aufgabe war klar: die gemeinsame Verteidigung im Falle eines Angriffs der Sowjetunion. 1952 traten auch Griechenland und die Türkei bei. Und am 9. Mai 1955, also drei Jahre später, trat auch Westdeutschland der NATO bei. Erst jetzt reagierten die Sowjetunion und die neun in ihrem Einfluss stehenden Staaten Mittel- und Osteuropas und gründeten, am 14. Mai 1955, also fünf Tage später, den Warschauer Pakt.

04.04.2021 15:28:15 [Heise]
Covid-19-Impfstoffpatente retten die Welt – oder auch nicht
Ohne Patente hätte es nicht so schnell Corona-Impfstoffe gegeben. Andererseits bremsen Impfstoffpatente die Massenproduktion aus. Gibt es einen Brückenschlag? Der Impfstoffanbieter Johnson & Johnson wird seine Lieferzusagen in den USA voraussichtlich nicht einhalten können. Die britische Impfkampagne droht angesichts eines neuen indischen Ausfuhrstopps ins Stolpern zu geraten. Und Europas Regierungen reagieren mit strengeren Ausfuhrkontrollen, um die knappen Corona-Impfstoffe im Staatenbund zu halten. Reicht das aus oder muss angesichts dieser Entwicklung auch die heilige Kuh "geistiges Eigentum" auf die Schlachtbank, um die Impfstoffproduktion weltweit ausweiten zu können und eine gerechte Verteilung zu sichern?
04.04.2021 17:14:50 [Cilip - Bürgerrechte & Polizei]
Frontex ohne Kontrolle
Im vergangenen Jahr haben verschiedene internationale Medien zusammengetragen und mit Videos und Berichten von Betroffenen belegt, wie Griechenlands Küstenwache in großem Umfang Geflüchtete in der Ägäis völkerrechtswidrig in die Türkei zurückschiebt. An diesen Push Backs sind auch Einheiten beteiligt, die einzelne EU-Mitgliedstaaten im Rahmen der Frontex-Mission „Poseidon Sea“ nach Griechenland entsandt haben. Auch die Bundespolizei soll dabei mitgeholfen haben, etwa am 10. August 2020, als die Beamte ein überfülltes Schlauchboot mit rund 40 Menschen an Bord gestoppt und anschließend der griechischen Küstenwache übergeben haben.
04.04.2021 17:30:25 [Brave New Europe]
Financial fictions: the old ones
The finance sector carries on just as before, engaging in speculation and regulators cannot and do not stop them. I must declare an interest. In days of old, many moons ago, I worked for an investment consultancy that advised Bill Hwang, the owner of Archegos, the ‘family office’ hedge fund that recently collapsed leaving $20bn owed to two big banks, Credit Suisse and Nomura.

Hwang was then a ‘Tiger cub’, someone that veteran hedge fund manager, Julian Robertson of the pioneering Tiger hedge fund showed favour on with ‘seed’ investment capital. After leaving Tiger, Hwang struck out on his own back in 2001 to great success.

04.04.2021 18:50:43 [SoZ - Sozialistische Zeitung]
Vom Geschäft mit der Behinderung
Selbst entwickelte Produkte aus Behindertenwerkstätten, das war einmal. Heute arbeiten Menschen mit Behinderungen vor allem für große und kleine Unternehmen – für ein Taschengeld.

Über zehn Millionen Menschen mit Behinderung leben in Deutschland. 7,9 Millionen davon haben eine schwere Behinderung. 2017 waren, laut statistischem Bundesamt, dreißig Prozent auf dem allgemeinen Arbeitsmarkt beschäftigt. Rund 320000 arbeiten in einer «Werkstatt für Menschen mit Behinderung» (WfbM). Sie fertigen und vermarkten nicht nur selbstentwickelte Produkte, etwa Holzspielzeug. Das war einmal. Heute bieten sie eine breite Palette an Fertigungen und Dienstleistungen für externe Auftraggeber an.

05.04.2021 06:54:59 [KenFM]
Afghanistan: über 20 Jahre Krieg, Leid, Chaos und kein Ende
Vor einem Jahr vereinbarte US-Präsident Trump mit den Taliban in Doha ein Abkommen über den Abzug der US-Truppen bis Mai 2021. Die Biden-Administration hält dieses Abkommen für kaum hinnehmbar und will es nun korrigieren. Jake Sullivan, Präsident Bidens neuer Sicherheitsberater betonte am 23. Januar 2021, dass „die USA den Friedensprozess mit robusten und regionalen diplomatischen Anstrengungen unterstützen werden“. Unter “robusten” Anstrengungen wird in der US-Administration meist der massive Einsatz von Militär verstanden. Der sich daraus ergebende Druck soll dann “diplomatische Erfolge” ermöglichen. Das hat bisher eigentlich nie funktioniert.
05.04.2021 09:54:54 [SoZ - Sozialistische Zeitung]
Bertelsmann u.a. wollen Krankenhäuser auf dem Land schließen
Mehr als je zuvor sind Krankenhausschließungen in der Corona-Pandemie unpopulär geworden, immerhin mussten – und müssen wieder – heftige Einschnitte der Grundfreiheiten mit dem Verweis auf die Kapazitätsgrenzen der Krankenhäuser hingenommen werden. Dennoch werden die Schließungen weiter betrieben.

Ihre Befürworter versuchen, sie möglichst geräuschlos über die Bühne zu bringen und bemühen eine verschleiernde Sprache.
Es geht um einen riesigen Markt: Etwa 400 Milliarden Euro werden im Gesundheitssektor Jahr für Jahr umgesetzt, Tendenz steigend. Sein Anteil am Bruttosozialprodukt ist doppelt so hoch wie der der Autoindustrie. Allein 100 Milliarden gehen in die Krankenhäuser. Das weckt seit vielen Jahren Begehrlichkeiten.

05.04.2021 12:26:14 [Der Freitag]
Jordanien – Angst vor Putsch
Ist Jordanien das nächste Land, das ins Chaos gestürzt wird? Der jordanische Prinz Hamsa, Halbbruder des jordanischen Königs Abdullah II. und ehemals als Thronfolger vorgesehen, soll in einen Putschversuch verwickelt sein. Das Militär forderte ihn dazu auf, Handlungen einzustellen, die die „Sicherheit und Stabilität“ des Landes gefährden.

In einem Video warf der Prinz der jordanischen Regierung unter Abdulah II. Inkompetenz, Korruption und einen Zusammenbruch der Regierungsstrukturen vor. Laut eigener Aussage steht Prinz Hamsa nun unter Hausarrest, was von Regierungsseite bestritten wird.

05.04.2021 17:04:43 [Norbert Häring]
Unter den Unternehmern grassiert das Virus des Widerstands
In Oberbayern hat sich Widerstand gegen die Lockdown-Politik der Regierungen formiert. Die Inhaber kleiner und mittelständischer Unternehmen vernetzen sich, um in den Wahlkreisen politischen Druck aufzubauen. Auch auf das übrige Bayern und die übrige Republik ist das Virus des Widerstands bereits übergesprungen. Noch könnte es aber eingedämmt werden.

Je kleiner die Unternehmen, desto größter derzeit die Klagen über Corona-Restriktionen und ausbleibende oder stark verzögerte staatliche Hilfen. Anders als Großunternehmen wie Lufthansa, Tui oder die Autobauer haben kleine Autohäuser, Bäckereien, Hotels und Metallbaubetriebe keine effektive Lobby, die ihren Anliegen in der Politik Gehört verschaffen könnte.

05.04.2021 17:19:32 [RT DE]
"Avatar": Wie die US-Marine erst als Berater fungierte und den Film später kritisierte
Das 3D-Science-Fiction-Epos "Avatar" wurde vor kurzem in China wiederveröffentlicht. Die Einnahmen aus der Volksrepublik haben dazu geführt, dass der Film den vorherigen Spitzenreiter Avengers: Endgame überholt und seine Position als umsatzstärkster Film aller Zeiten zurückerobert hat.

Diese Dominanz der Kassenstatistiken hat zu einer Flut von Nachrichtenberichten geführt, aber hinter den endlosen Berichten von Journalisten mit Dollarzeichen in den Augen verbirgt sich eine Geschichte über verdeckte Militärpropaganda und wie das Verteidigungsministerium Filmemacher unter Druck setzt, mehr Pro-Kriegsinhalte zu produzieren.

06.04.2021 06:55:25 [RT DE]
Die Beweismittel-Designer und Plagiatoren von Bellingcat
Mit der Veröffentlichung eines Brief des OPCW-Generaldirektors Arias an einen ehemaligen OPCW-Mitarbeiter wollte die "Investigativplattform" Bellingcat Kritiker mundtot machen, die Zweifel an der Verantwortung der syrischen Regierung am Giftgaseinsatz in Duma im April 2018 hegten. Doch den Brief hat es nie gegeben. Wie das Portal "The Grayzone" herausfand, handelte es sich um eine Fälschung. Bellingcat-Aktivist Nick Waters stellte sich an jenem Tag als Zeuge "Frank Palmer" samt den von ihm vorgetragenen "Beweise" vor einen "echten Richter", der wiederum über die Beweiskraft von "Palmers" Findungen ein "Urteil" fällen sollte.
06.04.2021 07:15:41 [Brave New Europe]
The Peoples Vaccine campaign
I have to admit until recently I didn’t know much about it either.

But if you go to their website you find the campaign promotes the speedy production of Covid19 vaccines for the world. Given that a vaccine reduces substantially the risks associated with Covid19 and for most people in the world there will be months and years before there is a chance of a vaccine, it means that any delay in producing vaccines will be fatal.

The campaign itself is supported by the heads of 100 countries, including India and South Africa but also Italy, Finland, and Pakistan. The list of supporting organisations and supporters is a long and distinguished one.

06.04.2021 09:19:03 [Ceiberweiber]
Wie Korruption verschleiert wird
Im ersten Moment erscheint es wohl seltsam zu behaupten, dass „Aufdecken“ von Korruption sehr oft in Wahrheit der Verschleierung dient. Wir sollten aber bereits stutzig werden, wenn Chatprotokolle von ÖBAG-Chef Thomas Schmid breit medial ausgewalzt werden, die auch Bundeskanzler Sebastian Kurz und Finanzminister Gernot Blümel betreffen. Denn damit werden Emotionen geschürt und holzschnittartige Bilder geschaffen, was davon ablenkt, sich Zusammenhänge anzusehen. Wie wir manipuliert werden, sei am Beispiel des „profil“ erklärt siehe unten eingebundenes Video. Das „profil“ gehört wie der „trend“ zum „Kurier“ und damit Raiffeisen und teilweise auch Rene Benko. Dieser wiederum bekommt Kredit u.a. von der Bank of China, der Sberbank Europe und von Raiffeisen.
06.04.2021 13:01:35 [Junge Welt]
Illegale Waffenexporte nach Mexiko: »Das ist eine Art Zwei-Klassen-Justiz«
BGH-Urteil bestätigt Strafe für Waffenschmiede Heckler & Koch. Freisprüche für oberste Führungsebene. Ein Gespräch mit Jürgen Grässlin: Im Fall der illegalen Rüstungsexporte von Heckler & Koch, H & K, nach Mexiko hatten Sie Strafanzeige gestellt. Dem Konzern wurden nun nach dem Urteil des Bundesgerichtshofs, BGH, in Karlsruhe am Dienstag (siehe jW vom 31.3.) mehr als drei Millionen Euro aus dem Geschäft eingezogen. Aber wurden auch die Entscheider im Rüstungskonzern und im Wirtschaftsministerium zur Verantwortung gezogen?

Erstmalig in der mehr als 70jährigen Konzerngeschichte des größten Exporteurs sogenannter Kleinwaffen konnten wir eine Verurteilung wegen widerrechtlichen Waffenhandels erreichen.

06.04.2021 15:03:29 [Der Freitag]
Moslembruderschaft und libyscher Finanzsektor
Sidiq al-Kebir ist auf dem Posten als Direktor der Libyschen Zentralbank (CBL) nicht mehr zu halten. Um der Moslembruderschaft auch nach seiner Zeit den Zugang zu den libyschen Öleinnahmen zu sichern, verfügte er nun als eine seiner letzten Handlungen einen Erlass, der die Bildung eines Interimsverwaltungsausschusses für die Libysche Auslandsbank (LFB) vorsieht. Laut diesem Erlass müssen nicht nur die Einlagen bei der Libyschen Auslandsbank an die CBL zurückgegeben werden, sondern es soll auch die Leitung des Ausschusses einem Moslembruder übertragen werden.
07.04.2021 06:46:15 [RT DE]
Wiener Verwaltungsgericht stellt sich gegen das Corona-Regime – und keinen interessiert es
Am 24. März 2021 erklärte das Verwaltungsgericht Wien den Kern der Corona-Maßnahmen für untauglich. Das betrifft unter anderem die Schutzwirkung von FFP2-Masken und die Aussagekraft von PCR-Tests. Doch kaum einer berichtete darüber. Dieses sensationelle Urteil, das die zentrale Argumentationskette des gesamten, über ein Jahr bestehenden österreichischen Corona-Regimes kippt, ergibt sich aus einem Schiedsspruch, den die Freiheitliche Partei Österreichs (FPÖ) gegen die Landespolizeidirektion Wien erstritten hat. Dabei ging es um die polizeiliche Untersagung einer für den 31. Januar 2021 angemeldeten Demonstration, die sich unter anderem gegen Ausgangssperren wandte.
07.04.2021 09:17:28 [Norbert Häring]
Maas will mit der US-Regierung eine Zensurallianz für soziale Medien schmieden
Bundesaußenminister Heiko Maas, als Justizminister Schöpfer des berüchtigten Gesetzes zur Durchsetzung von Zensur in (sozialen) Netzwerken (NetzDG), hat angekündigt, gemeinsam mit der US-Regierung an der Kontrolle und Lenkung der sozialen Medien arbeiten zu wollen.

Nach einem Bericht des Handelsblatts sagte Maas:

Die EU wird nicht allein für eine sichere Onlinekommunikation sorgen können, dafür brauchen wir starke Partner.”

Dafür hat das Auswärtige Amt zusammen mit dem Institute for Strategic Dialogue (ISD) das „Digital Policy Lab“ gegründet, das Entscheider aus der EU, den USA und anderen Ländern zusammenbringt.

07.04.2021 13:10:27 [Junge Welt]
Digtiale Massenüberwachung: »Wäre die größte anzunehmende Katastrophe«
EU und USA planen Durchleuchtung verschlüsselter privater Kommunikation. Messengerdienste sollen Behörden zuarbeiten. Ein Gespräch mit Matthias Monroy: Weitgehend unbemerkt wird in der EU weiter an der Überwachung verschlüsselter Kommunikation gebastelt. Mitte April findet ein wichtiges Treffen statt. Worum geht es?

Am 14. und 15. April kommen hochrangige Beamte der EU und der USA zum Thema »Justiz und Inneres« zusammen. Auf diesen regelmäßig stattfindenden Treffen werden Maßnahmen zu Terrorismus, Cyberkriminalität oder Migration behandelt. Diesmal stehen wieder »Herausforderungen im Zusammenhang mit Verschlüsselung und rechtmäßigem Abhören« auf der Tagesordnung.

07.04.2021 13:15:47 [Buchkomplizen]
Journalismus der Halbwahrheiten im Konflikt Ukraine/Nato und Russland
Journalisten sind gerne fürsorglich, wenn sie als Pseudogeneräle im Lehnstuhl sitzen, und klagen an, dass Deutschland doch endlich mal „verantwortlich“ handeln, also aufrüsten und vermehrt für Auslandseinsätze bereit soll, und, wenn es um die „russische Gefahr“, bereits zum geflügelten Wort geworden, geht, mehr abschrecken und provozieren müsste. Daniel Brössler sticht da komplexitätsreduzierend hervor und rügt gerade in einem Kommentar in der Süddeutschen Zeitung die deutsche und französische Regierung, weil die nur zur Zurückhaltung aufgefordert haben, wo doch die „militärische Machtschau an den Grenzen der Ukraine“ der Erinnerung an russisches Fehlverhalten auf die Beine helfen sollte.
07.04.2021 14:49:38 [NachDenkSeiten]
Jetzt auch die Ukraine in die Nato?
Ein Gastbeitrag von Oskar Lafontaine: Der ukrainische Präsident Wolodymyr Selensky wirbt für einen schnellen Beitritt seines Landes in die Nato. Das ist ein Spiel mit dem Feuer. Ein Blick auf die Landkarte zeigt, dass die aggressivste und stärkste Militärmacht der Welt, die USA, seit Jahren Russland und China einkreist. Da auch Russland und China imperiale Mächte sind, muss sich jeder klar Denkende die Frage stellen, wie lange das gut gehen kann. Was Russland angeht: Man kann sich vorstellen, wie Gorbatschow sich fühlt, wenn er sieht, was passiert, nachdem der Warschauer Pakt aufgelöst und die russischen Truppen aus Osteuropa abgezogen wurden.
07.04.2021 16:12:13 [Klimareporter]
Kambodscha: Kommt illegale Landnahme zur Anklage?
Seit sechs Jahren liegt beim Internationalen Strafgerichtshof in Den Haag eine Beschwerde gegen Kambodscha. Doch nun könnte Bewegung in den Fall kommen. Chefanklägerin Fatou Bensouda hat in einer Rede im Februar versprochen, endlich zu entscheiden, ob eine formelle Untersuchung eingeleitet werden soll.

Die Größenordnung des Falls ist beachtlich. Seit der Gründung des Gerichts im Jahr 2002 wurden 830.000 Menschen von ihrem Land vertrieben, das anschließend an wohlhabende Geschäftsleute verpachtet wird.

07.04.2021 17:16:11 [Blätter]
Griechenland: Deutschlands lange verdrängte Kriegsschuld
Am 6. April jährte sich zum 80. Mal der deutsche Angriff auf Griechenland. Und nach wie vor sind die deutschen Verbrechen im Zweiten Weltkrieg im kollektiven Gedächtnis der Griechen tief verankert. Zugleich ist die Bereitschaft Deutschlands bis heute beschämend gering, Griechenland für die Zerstörung und Ausplünderung des Landes und das den Menschen zugefügte Leid zu entschädigen. Griechenland war, außer als Ferienland, erstaunlich lange aus dem Blickfeld der meisten Deutschen geraten. Erst der Konflikt zwischen beiden Ländern zur Schuldenkrise vor gut zehn Jahren hatte den Nebeneffekt, dass Deutsche sich zunehmend für Griechenland interessierten und die beiden Staaten sich – paradoxerweise – nähergekommen sind.
08.04.2021 07:18:24 [Telepolis]
Luca-App: Keine Risikoanalyse, aber viele offene Fragen
Das Debakel um die Luca-App zur Kontaktnachverfolgung. Teil 2: Smudo und die Datenhoheit. Vieles erscheint angesichts des technologischen Desasters um die Luca-App zur Kontaktnachverfolgung in der Corona-Pandemie fragwürdig. Gute Werbung für Luca ist das allemal, auch wenn sich mehr und mehr Datenschützer mit kritischen Einschätzungen melden. Das verwundert nicht, denn eine zwingend vorgeschaltete Datenschutz-Folgenabschätzung – "eine in bestimmten Fällen vorgeschriebene, strukturierte Risikoanalyse zur Vorabbewertung der möglichen Folgen von Datenverarbeitungsvorgängen" – fand offensichtlich bis heute nicht statt.
08.04.2021 11:19:11 [Anti-Spiegel]
Die Eskalation um den Donbass seit Anfang April
Die westlichen Medien haben das Thema Ukraine wieder entdeckt und berichten nun täglich über die Eskalation und angebliche Aggression Russlands. Damit sichtbar wird, was sie dabei alles verheimlichen, werde ich hier die Entwicklungen seit Anfang April aufzeigen. Selensky hat seit Februar systematisch jede Opposition und auch jede kritische Presse ausgeschaltet, in dem er gesetzwidrig sowohl die letzten regierungskritischen TV-Sender verboten, als auch den Oppositionsführer im Parlament enteignet hat. Außerdem hat er fast 500 kritische Internetseiten sperren lassen.

Der Sinn dieser schnell durchgezogenen, rigorosen Maßnahmen wird nun offensichtlich.

08.04.2021 13:07:36 [Junge Welt]
Automobilklub: Vollgas für die gute Tat
ADAC-Regionalchef Meyer gründet Stiftung und baut damit eigene Machtbasis aus. Unternehmer, die etwas auf sich halten, gründen eine Stiftung. Unter dem Banner, Gutes zu tun und dem Gemeinwohl zu dienen, sparen sie nebenbei reichlich Steuern, die dem Gemeinwohl dann wieder fehlen. Wobei die Macher letzteres für gewöhnlich nicht so herausstellen wie ihre Gönnerpose. Peter Meyer macht da keine Ausnahme. Der 71jährige ist Chef des ADAC Nordrhein, des größten der 18 regionalen Ableger des Allgemeinen Deutschen Automobilclubs. Der ehemalige Spediteur und Unternehmensberater muss seinen Posten im Mai altersbedingt räumen, denkt aber gar nicht daran, damit auch seinen Einfluss in Europas größtem Spritfresserverein aufzugeben.
08.04.2021 13:17:03 [Blätter]
Die große Trennung
Die Geburt der technokratischen Weltsicht und die planetarische Krise. Die Krise des durch massive menschliche Eingriffe beschädigten Lebens auf der Erde, die unter dem Namen Anthropozän firmiert, ist eng mit einem technokratischen Programm verbunden, das die Natur zu einer abgespaltenen und beherrschbaren Ressource in der Hand des Menschen degradiert. Obwohl die Naturwissenschaften – von der Quantenphysik bis zur Systembiologie – diese Vorstellung zum Teil längst überwunden haben, ist die technokratische Ideologie heute wirkmächtiger denn je. Der Grund dafür liegt in der engen Verbindung dieses Weltbildes mit dem vorherrschenden Wirtschaftsmodell.
08.04.2021 18:55:21 [TAZ]
Gemeinsame Impfstoff-Strategie vor Aus: Sputnik V spaltet EU
Berlin und Brüssel gehen bei der Impfstoff-Strategie künftig getrennte Wege. Während die Bundesregierung den umstrittenen russischen Impfstoff Sputnik V beschaffen will, lehnt die EU-Kommission dies weiter ab. Man habe sich deshalb zu einem Alleingang entschlossen, sagte Bundesgesundheitsminister Jens Spahn (CDU) am Donnerstag.

Bislang hatte die EU die Beschaffung übernommen, wie es Bundeskanzlerin Angela Merkel und EU-Kommissionspräsidentin Ursula von der Leyen (beide CDU) im Sommer 2020 vereinbart hatten. Doch angesichts der anhaltenden Lieferprobleme bei den gemeinsam bestellten Vakzinen will Berlin nun ausscheren.

08.04.2021 19:07:55 [M 7]
Krieg und Coronoia
Was für ein Debakel! Nun formuliert der Präsident der Ukraine, Selenski, den Wunsch seines Landes nach NATO-Mitgliedschaft. Es mutet an wie ein grausiges Déjà-vu. So als hätte es den vergeblichen Versuch 2014 nicht gegeben, mit der Ukraine das letzte Glied in die Kette mit aufzunehmen, die die Einkreisung Russlands schließt. Ein Blick in die jüngere Geschichte genügt, um die ganze Perfidie und Verlogenheit ins Gedächtnis zu rufen, mit der das Entgegenkommen Russlands bei der Beendigung des Kalten Krieges und der Wiedervereinigung Deutschlands seitens der USA und ihrer sich als Mündel benehmenden Staaten beantwortet wurde. Keine Osterweiterung der NATO, hieß es da. Man sehe sich die Landkarte heute an.
08.04.2021 19:11:12 [Egon W. Kreutzer]
Die Bürokratie und ihre Kritiker
Wenn sich Elon Musk, der mit deutschen Steuermilliarden gepamperte US-Milliardär, mit der DUH verbündet und deren Klage gegen die Bundesregierung unterstützt, und man in Berlin immer noch nicht mit der Faust auf den Tisch haut, dann stimmt das mehr als nur bedenklich. Aber: Wer es so weit hat kommen lassen, der kehrt solchen Ärger lieber unter den Teppich.

250 Jahre lang hat die von Friedrich dem Großen gelegte, deutsche Verwaltungsstruktur perfekt funktioniert. Die Frage ist, was ist in den letzten 30 Jahren schiefgegangen? Seht ihr irgendwo noch einen Retter?

Laschet? Söder? Scholz? Baerbock? Habeck? Wellsow? Lindner?

Zwei oder drei davon werden demnächst die Regierung anführen. Mir macht das Angst.

09.04.2021 08:58:46 [Anti-Spiegel]
Impfstoffmangel in der EU
Die EU beklagt zwar einen Mangel an Impfstoffen, weigert sich jedoch, den russischen Impfstoff zu bestellen. Deutlicher kann die EU gar nicht zeigen, dass es ihr nicht um Impfungen, sondern um die Gewinne der westlichen Pharmakonzerne geht. Die EU hat im August 2020 angefangen, Vorverträge mit westlichen Pharmakonzernen wie AstraZeneca oder BionTech/Pfizer abzuschließen, obwohl damals noch nicht einmal klar war, ob es ihnen überhaupt gelingt, Impfstoffe zu entwickeln. Trotzdem wurde ihnen Vorkasse gezahlt, die auch im Falle eines Scheiterns bei der Entwicklung von Impfstoffen nicht rückzahlbar war. Hinzu kommt, dass die EU die westlichen Pharmakonzerne auch gleich noch von der Haftung für alles, angefangen bei Impfschäden bis hin zu verspäteter Lieferung, befreit hat. Für dieses Rundum-Sorglos-Paket für die Pharmakonzerne hat die EU Milliarden bezahlt.
09.04.2021 09:10:53 [RT DE]
Corona-Maßnahmen führen zu drastischem Ausmaß an Rechtsverstößen in Pflegeheimen
Der Freiheit komplett beraubt im Heim: Seit über einem Jahr sind pflegebedürftige Senioren einem strengen Corona-Regime ausgesetzt. Doch bei der bloßen Umsetzung der repressiven Verordnungsregeln blieb es häufig nicht. Viele Einrichtungen schießen wohl bis heute gravierend über das Ziel hinaus. Sie werden am Spaziergang gehindert, bekommen Quarantäne angedroht oder werden sogar von der Leitung selbst in den Arrest gesteckt: Unter derartiger Entrechtung leiden offenbar viele Pflegeheimbewohner seit dem Ausrufen der "epidemischen Notlage" vor über einem Jahr. Dieses Zwischenfazit zog kürzlich die Verbraucherzentrale Sachsen-Anhalt aus einer laufenden Umfrage unter Betroffenen und Angehörigen in ihrem Bundesland.
09.04.2021 11:35:49 [Police IT]
Zum Stand der Kenn­zeich­nungs­pflichten in polizeilichen Informationssystemen
Nicht neu, aber weitgehend ignoriert, ist die Pflicht zur Kennzeichnung des Zwecks von polizeilich erhobenen Informationen mit Personenbezug. Daher hat der Bundesdatenschutzbeauftragte in einem Positionspapier mal wieder auf das Thema aufmerksam gemacht. POLICE-IT begleitet das Thema auch mit Presseanfragen bereits seit Jahren. Hier ist ein Überblick über den aktuellen Stand der (Nicht-)Umsetzung dieser gesetzlichen Pflichten. Der Bundesdatenschutzbeauftragte hat ein Positionspapier vorgelegt zum ‚Grundsatz der Zweckbindung in polizeilichen Informationssystemen‘.

Es war notwendig und richtig, wieder einmal an diese schon seit langem bestehende gesetzliche Pflicht zu erinnern. Allerdings sind die vier Seiten sehr abstrakt und trocken geraten.

09.04.2021 13:26:29 [Neue Zürcher Zeitung]
Der Traum vom internierten Bürger
Warum man autoritären Politikern wie Markus Söder widersprechen muss. Der bayrische Ministerpräsident würde am liebsten in ganz Deutschland eine nächtliche Ausgangssperre verhängen. Dabei gibt es keinen Beleg dafür, dass diese Form der Freiheitsberaubung etwas bringt. Wenn überhaupt, dann dient sie seinem Inszenierungsfuror. Es gibt ein einziges Argument für Ausgangssperren, und es ist kein gutes: Wer sich als Politiker als besonders entschlossener Kämpfer gegen die Pandemie inszenieren will, der wirkt als Befürworter dieser Massnahme noch ein bisschen entschlossener.
09.04.2021 14:46:44 [Telepolis]
Wenn Politik sich ins Security-Theater flüchtet
Das Debakel um die Luca-App zur Kontaktnachverfolgung. Teil 3 und Schluss: Kaputtgesparte Behörden, kritische Datenschützer und seltsame Entscheidungen von Politikern. Die Unfähigkeit der Politik, die daraus resultierende Machtlosigkeit der kaputtgesparten Behörden und das Wunschdenken der coronageplagten Bürger münden in ein leidiges Security Theater, in Sicherheitsmaßnahmen, die ein gutes Gefühl vermitteln, tatsächlich aber keinen Effekt haben.

Und es geht um kognitive Dissonanzen: Weil Rapper Smudo für Erfolg und positives Denken steht, muss auch die Luca-App erfolgreich und positiv sein, das geht gar nicht anders.

09.04.2021 15:56:27 [Norbert Häring]
Die überaus wacklige Rechtfertigung des RKI für die geplanten Privilegien für Geimpfte
In einer Stellungnahme für die Ministerpräsidentenkonferenz erweckt der Chef des Robert Koch Instituts, Wieler, den Eindruck, wer geimpft ist, sei nicht mehr ansteckend. So hilft er, Privilegien für Geimpfte zu rechtfertigen. Das RKI hat guten Grund, dieses Pamphlet vor der Öffentlichkeit verstecken zu wollen.

Man ist misstrauisch geworden, nach all den falschen und verzerrten Aussagen, die die Behörde RKI schon losgelassen hat, um die Corona-Politik der Regierung zu stützen. So etwa jüngst die abseitige Behauptung, das massenhafte Ausrollen von Schnelltests habe nicht nennenswert zur Dritten Welle der positiv Getesteten je 100.000 Einwohner (nicht je Tests) beigetragen.

09.04.2021 18:57:47 [Anderwelt Online]
Die NATO missbraucht die Ukraine als Kriegsgrund gegen Russland
Der Krieg gegen Russland war eigentlich schon für den Sommer 2014 geplant. Mit dem Abschuss der MH 17 sollte ein „gerechter“ Krieg gegen den „russischen Aggressor“ begründet werden, nachdem in Kiew ein vorbereitender Putsch durchgezogen worden ist. Mit Donald Trump herrschte Ruhe an dieser Front. Jetzt startet Biden dieses Programm erneut. Die Darstellung der Abläufe um die Ukraine ist in unseren Medien wieder einmal lückenhaft. Sie beginnt zu spät. Schon vor einigen Wochen meldete die ukrainische Generalität, ihre Vorbereitungen für den endgültigen Angriff auf die abtrünnigen Provinzen im Osten seien abgeschlossen.
09.04.2021 19:05:32 [Aktuelle Sozialpolitik]
Licht und Schatten in der Fleischindustrie
Wie sieht es aus an den Fließbändern der deutschen Schlachtindustrie? Im vergangenen ersten Corona-Jahr war das – für einen Moment – eines der ganz großen Themen (gewesen): die Situation in den Schlachthöfen des Landes. Die oftmals mehr als skandalösen Arbeits- und Lebensbedingungen der zumeist aus Osteuropa angeheuerten Arbeitskräfte wurden im Kontext von Corona-Hotspots bei Tönnies & Co. auf die Fernsehbildschirme und die Zeitungen gespült. Nicht, dass das bis dahin kein Thema gewesen war – schon seit Jahren wurde immer wieder über die Missstände in den deutschen Billig-Schlachthäusern berichtet.
10.04.2021 06:53:47 [Junge Welt]
Abbau Ost
Ostdeutschland ist das Eldorado für das deutsche Kapital. Der Staat fördert Konzernansiedlungen und schröpft die lohnabhängige Bevölkerung. So ist die Zahl der Sozialwohnungen auf dem Gebiet der DDR innerhalb von vier Jahren um knapp 43 Prozent gesunken. Das geht aus einer Antwort der Bundesregierung auf eine Frage der Bundestagsabgeordneten Caren Lay (Die Linke) hervor, wie dpa am Freitag berichtete. Obwohl neue Sozialwohnungen gebaut wurden, schrumpfte der Bestand zwischen 2015 und 2019 von 102.116 auf nur noch 58.604 Wohnungen. Am stärksten war der Rückgang in Sachsen-Anhalt (mehr als 70 Prozent), wo Ende 2019 nur noch 3.510 Sozialwohnungen übrig waren.
10.04.2021 08:47:52 [Infosperber]
So löcherten Lobbyisten das deutsche Lieferkettengesetz
In Deutschland soll bald ein Lieferkettengesetz in Kraft treten. Allerdings haben es Lobbyisten zum zahnlosen Papiertiger gemacht.

Ende November 2020 scheiterte die Schweizer Volksinitiative «Für verantwortungsvolle Unternehmen – zum Schutz von Mensch und Umwelt» (Konzernverantwortungsinitiative) am Ständemehr. Obwohl sich ein breites Bündnis für neue Regeln für in der Schweiz ansässige Unternehmen, die im Ausland tätig sind, einsetzten und Nichtregierungsorganisationen lange auf die Abstimmung hingearbeitet hatten, erhält die Schweiz nach dem Scheitern der Initiative mit dem Inkrafttreten des indirekten Gegenvorschlags nun eine deutlich abgeschwächte Konzernhaftung.

10.04.2021 11:23:00 [NachDenkSeiten]
Unteilbar und die „antisemitisch konnotierten Verschwörungserzählungen“ der „Pandemieleugner“
Die Initiative Unteilbar hat in einem infamen Aufruf die jüngsten Proteste gegen die Corona-Politik pauschal diffamiert. Im Gewand theoretischer Kritik wird die offizielle Corona-Politik in der Praxis verteidigt. Der Appell wird von zahlreichen Medien, Initiativen und Gewerkschaftern unterstützt. Anlässlich „erneuter Mobilisierungen von ‚Querdenken‘ und anderen Pandemieleugner im Frühling 2021“ sah sich die Initiative „Unteilbar“ kürzlich aufgerufen, eine Erklärung mit dem Titel „Freiheit geht nur solidarisch“ abzugeben. Man könnte das ignorieren, die Resonanz in Form von Unterschriften hält sich in Grenzen.
10.04.2021 13:24:54 [Ständige Publikumskonferenz]
Joe Biden im Tagesschau-Weichzeichner
Der US-Präsident und die „westliche Wertegemeinschaft“ sind für die Kriegsgefahr in der Ukraine und das Elend der Bevölkerung verantwortlich. Tagesschau-Meldung ohne gedankliche Vorleistung: „Der Konflikt um die Ostukraine heizt die Spannungen zwischen den USA und Russland an.“ Hoppla. Kleine Analyse: Wer (Subjekt)? Der Konflikt. Satzaussage? Heizt an. Wen oder was (Objekt)? Die Spannungen. Ach so. Der Konflikt, dieser Kotzbrocken! Damit wir trotz solch erbärmlicher Sprache ins gewünschte Bild gesetzt werden, kloppt Tagesschau-Expertin Silvia Stöber mit ihrem nächsten Satz den Rahmen drumherum fest: „Berichten über umfangreiche Truppenbewegungen russischer Streitkräfte an die Grenze der Ukraine folgten Warnungen und Drohgebärden.“ (ebd.) Und schon liegen wir wieder richtig: Der Russe ist schuld.
10.04.2021 16:59:47 [Amerika 21]
Das Geschäft mit dem Impfstoff gegen Covid-19
Als wären die Trostlosigkeit der Ausgangssperre, die Sorge vor neuen Ansteckungen und die Trauer um diejenigen, die von der Pandemie auf eine andere Ebene geweht wurden, nicht genug, empfinden wir auch eine tiefe Empörung, wenn eine der unmenschlichsten Anti-Werte des Kapitalismus hervortritt: aus Leben und Gesundheit ein Geschäft zu machen.

Die USA, die Europäische Union und Großbritannien wehren sich gegen den Vorschlag, den Corona-Impfstoff von geistigen Eigentumsrechten und Patenten auszunehmen. Besagter Vorschlag wurde im Oktober 2020 von Südafrika und Indien bei der Welthandelsorganisation (WTO) eingereicht.

10.04.2021 17:17:50 [WOZ - Die Wochenzeitung]
EU-Aussengrenze: «Frontex ist ein Symptom»
Die EU-Abgeordnete Tineke Strik untersucht mutmassliche Menschenrechtsverletzungen durch die europäische Grenzschutzagentur Frontex. Im Gespräch erklärt sie, wie diese zu einer Polizeimacht fast ohne Aufsicht werden konnte. WOZ: Frau Strik, Sie untersuchen mit einer Arbeitsgruppe die Vorwürfe gegen die EU-Grenzschutzagentur Frontex. Worum geht es konkret?
Tineke Strik: Es geht um die Vorwürfe bezüglich Menschenrechtsverletzungen an der europäischen Aussengrenze und die Rolle, die Frontex dabei spielt. Direkter Anlass dafür sind die Berichte der Investigativplattform «Bellingcat» über die griechischen Pushbacks, bei denen Frontex Zeugin war – oder an denen die Agentur womöglich selbst beteiligt war.

11.04.2021 09:52:51 [RT DE]
Im Kalten Krieg gegen China haben die USA schlechte Karten
Teil 2: Was China betrifft, so sind nicht nur die technologischen Fortschritte des Landes zu erwähnen, die vor zehn Jahren noch unvorstellbar waren, sondern auch die wissenschaftlich-organisatorischen Fähigkeiten, theoretische Durchbrüche in die Tat umzusetzen. Grundlage dieser Entwicklung ist – im Gegensatz zu den USA – die hervorragende und vor allem kostenlose Ausbildung aller Chinesen. So verwundert es nicht, dass in China seit Jahrzehnten mehr Akademiker in Mathematik und Naturwissenschaften mit Doktorgrad oder äquivalenten Qualifikationen abschließen als in den USA und der EU zusammengenommen.
11.04.2021 13:20:49 [NachDenkSeiten]
Wenn schon nicht reisen – wenigstens dran denken
Wenige Bauwerke auf dieser Welt genießen so viel Bewunderung wie die geheimnisumwitterte Höhensiedlung Machu Picchu aus der Zeit der Inka in Peru. Trotzdem sind sich Archäologen und Historiker nicht ganz darüber im Klaren, warum Machu Picchu überhaupt gebaut wurde. Warum gerade dort – 80 km von der damaligen Hauptstadt Cusco entfernt – und weshalb so hoch oben? Wer hat dort gewohnt und was haben die Bewohner getan? Und warum konnte es eines Tages unzerstört verlassen und vom Tropenwald überwuchert werden? Zur Beantwortung dieser Fragen gibt es sehr unterschiedliche Thesen – restlos überzeugend ist keine.
11.04.2021 13:34:08 [M 7]
Monothematische Navigatoren
Diejenigen, die in liberaleren Zeiten ein Studium aufnahmen, können sich sicherlich auch an das Typische, noch etwas Pennälerhafte erinnern, das bei der Wahl eines Studiengangs zum Ausdruck kam, wenn eine Entscheidung gefallen war und man auf Bekannte traf, die sich für etwas anderes entschieden hatten. Da wurde dann über die Disziplinen gefrotzelt, die Weltfremdheit der Philosophen und Philologen, das Unzeitgemäße der Historiker, die Systembeschränktheit der Juristen, die Geldsucht der Mediziner, die Instrumentalisierbarkeit der Naturwissenschaftler etc.. Als das Studium dann richtig begann, haben sich alle, die auch nur etwas vom Wesen der Wissenschaften begriffen hatten, von diesem pubertären Schaulaufen verabschiedet, was nie ausschloss, dass es auch Menschen gab, die das Terrain der Dominanz ihrer eigenen Disziplin nie verlassen und sich auf dem Altar der Fachidiotie geopfert haben.
11.04.2021 15:29:44 [Der Freitag]
Syrien: Dann hungert mal
Die EU und die Vereinten Nationen wollen dem zerrütteten Land helfen. Hinter dem Verteilungssystem steckt allerdings ein erpresserisches Kalkül. Die fünfte Brüsseler Konferenz „Zur Unterstützung der Zukunft Syriens und der Region“ war durchaus ein Erfolg. Es gelang der EU und den Vereinten Nationen, Zusagen der Geberstaaten für 5,3 Milliarden Euro zu erhalten. Deutschland war mit fast 1,8 Milliarden Euro größter Einzelspender, doch liegt das Ergebnis weit unter dem angestrebten Ziel von zehn Milliarden. Die Hälfte ist ein substanzieller Betrag, nur bei Weitem nicht ausreichend, den Syrern beizustehen, wenn neun von zehn Menschen unterhalb der Armutsgrenze leben. Die UNO warnt vor einer Hungerkatastrophe.
11.04.2021 16:59:00 [Gewerkschaftsforum]
Unternehmerstaat Deutschland: „Menschrechte sind linke Ideologie“
Die Unternehmerlobby agiert mit den Pandemie-Maßnahmen so enthemmt wie nie, mit Zugriff auf das Parlament und im Parlament – insbesondere die abhängig Beschäftigten werden weiter entrechtet und verarmt, mit und ohne Gesetze.

Die Bundesregierung und Aufsichtsbehörden erweisen sich als Komplizen bei jahrelangen Großstraftaten wie dem Cum-Ex-Steuerbetrug und dem Abgas-Betrug, Abgeordnete von CDU und CSU agieren als korrupte Pandemie-Geschäftemacher, und die Bundeskanzlerin liest in Peking vom Spickzettel der Lobbyisten ab und empfiehlt das Betrugsunternehmen Wirecard – aber all das ist nur das leitmediengängig skandalisierte Gekräusel an der Oberfläche.

11.04.2021 19:05:30 [IMI-Online]
Mosambik: EU-Einsatz und Flüssiggas
Im Jahr 2010 stieg ein Konsortium unter heutiger Führung des französischen Total-Konzerns mit dem „Mosambik-Flüssiggasprojekt“ groß in das dortige Land ein. Es geht dabei um die anvisierte Ausbeutung von 65 Billionen Kubikfuß Gas, wofür 2019 entschieden wurde, bis 2024 insgesamt 20 Mrd. Dollar zu investieren. Im Juli vergangenen Jahres wurde bekanntgegeben, eine Vereinbarung für Investitionen im Umfang von 15 Mrd. Dollar sei unterzeichnet worden. Kein Pappenstiel also, was man im Hinterkopf behalten sollte, wenn man nun Nachrichten wie Ende März im Deutschlandfunk liest, die ehemalige Kolonialmacht Portugal plane die Entsendung von 60 Soldaten, um „die Streitkräfte in Mosambik mit Trainingsmaßnahmen dabei [zu] unterstützen, Dschihadisten im nördlich gelegenen Palma zu bekämpfen.“
11.04.2021 19:10:17 [Aktuelle Sozialpolitik]
Gewerkschaften in den USA
Eine Niederlage und dann auch noch gegen Amazon. Zugleich werden die bitteren Folgen der Atomisierung gewerkschaftlicher Gegenmacht in Dollar und Cent erkennbar. Fast alle klagen über die Folgen und die Belastungen durch die Corona-Pandemie und die Liste der Verlierer wird immer länger. Aber nicht wirklich alle werden darin einstimmen – denn wie immer gibt es auch Gewinner. Und ein Gewinner steht definitiv fest: Amazon. Schon das erste Corona-Jahr, also 2020, war ein „Geschenk“ für diesen global aufgestellten Konzern. Wenn man das gesamte Jahr 2020 berücksichtigt, dann wird der große Sprung deutlich erkennbar, den der Konzern mit dem Rückenwind der Corona-Pandemie hat machen können
 Aktuelle Themen (64)
01.04.2021 07:14:40 [Junge Welt]
Ostermärsche trotz Pandemie
In über 100 Städten und kleineren Ortschaften finden in den kommenden Tagen die traditionellen Ostermarschdemonstrationen der Friedensbewegung statt. Aufgrund der Coronapandemie und aktuell wieder ansteigender Infektionszahlen setzen einige Veranstalter in diesem Jahr auf stationäre Kundgebungen oder weichen auf Menschenketten aus, um ausreichend Abstand zwischen den Teilnehmenden zu wahren.

Während die Ostermärsche in einigen Städten virtuell stattfänden, seien sie etwa in Siegen, Ellwangen, Gifhorn und Miesbach komplett abgesagt worden, teilte das »Netzwerk Friedenskooperative« in einer am Dienstag veröffentlichten Pressemitteilung mit.

01.04.2021 11:41:09 [Buchkomplizen]
Bellingcat soll als Zeuge vorgeladen werden, nicht Sergei oder Julia Skripal
Die erste Sitzung der Untersuchung des Todes von Dawn Sturgess, die am Dienstag in London stattfand, war fast vollständig vorhersehbar.



Der Anwalt für den Gerichtsmediziner, ebenso wie die Anwälte der Sturgess-Familie und des Innenministeriums, wiederholt ohne Einschränkung die Behauptung, dass eine Nowitschok-Giftwaffe, die angeblich in Russland produziert und nach Großbritannien von russischen Attentätern gebracht wurde, den ungeplanten Tod von Sturgess verursacht habe. Dies geschah zwölf Wochen nach einem Attentatsversuch auf Sergei Skripal mit der gleichen Waffe am 4. März 2018. Sturgess war das unbeabsichtigte Opfer von Giftresten, heißt es.

01.04.2021 13:21:34 [TAZ]
Baden-Württemberg: Koalitionsentscheidung vertagt
Baden-Württembergs grüner Ministerpräsident Winfried Kretschmann muss in seiner eigenen Partei um eine Neuauflage der Koalition mit der CDU kämpfen. Der Landesvorstand vertagte am Donnerstag nach fast dreistündiger Diskussion völlig überraschend eine Entscheidung über den Partner für Koalitionsverhandlungen.

Die Landesvorsitzenden Sandra Detzer und Oliver Hildenbrand teilten dazu mit: „Eine Entscheidung mit solcher Tragweite für das Land und die Zukunft Baden-Württembergs erfordert ein gründliches und sorgfältiges Abwägen.“

01.04.2021 13:31:38 [Junge Welt]
Not lehrt bitten: Merkel an »Sputnik V« interessiert
Ende 1916 hielt Pawel Miljukow, Fraktionsvorsitzender der russischen »Kadetten«-Partei, eine berühmt gewordene ­Rede in der Staatsduma. In ungefähr zehn Punkten fasste er die Niederlagen, Fehlschläge, Affären und Skandale zusammen, die sich das zaristische Russland in zwei Jahren Weltkrieg geleistet hatte. Am Ende jedes Absatzes kam der suggestive Satz: »Ist das noch Dummheit, oder ist es schon Verrat?«

Schaut man auf das Schauspiel, das die Bundesregierung im Zusammenhang mit der Pandemiebekämpfung bietet, drängt sich die Erinnerung an diese Rede auf.

01.04.2021 15:31:58 [German Foreign Policy]
Berliner Politikberater fordern „Schulterschluss“ mit den USA gegen China
Die chinesische Gegenwehr gegen die jüngsten EU-Sanktionen treibt die Debatte um weitere Strafmaßnahmen und einen etwaigen engen Schulterschluss mit den Vereinigten Staaten voran. So wird etwa eine Abkehr von dem kürzlich vereinbarten Investitionsabkommen mit der Volksrepublik diskutiert. Das Abkommen war nach erheblichen Anstrengungen vor allem Berlins zustandegekommen; es trägt der Tatsache Rechnung, dass zentrale deutsche Konzerne existenziell auf das Chinageschäft angewiesen sind: Volkswagen und Infineon etwa erzielen rund zwei Fünftel ihres Umsatzes in der Volksrepublik.
01.04.2021 18:44:10 [Heise]
Gesetze gegen Hass und zur Passwortherausgabe treten in Kraft
Bundesjustizministerin Christine Lambrecht zeigte sich am Donnerstag erleichtert, dass das Gesetzespaket gegen Hass und Hetze nach einigen Verzögerungen und Auseinandersetzungen nun in veränderter Form doch noch greift. Die Initiative diene "dem Schutz aller Menschen, die im Netz bedroht und beleidigt werden", betonte die SPD-Politikerin. Künftig könnten Polizei und Justiz sehr viel entschiedener gegen menschenverachtende Hetze vorgehen: "Wir erhöhen die Abschreckung und den Ermittlungsdruck deutlich." Das Paket besteht aus dem "Gesetz zur Bekämpfung des Rechtsextremismus und der Hasskriminalität", das am Samstag in weiten Teilen in Kraft tritt, sowie dem ab Freitag geltenden "Gesetz zur Anpassung der Regelungen über die Bestandsdatenauskunft an die Vorgaben aus der Entscheidung des Bundesverfassungsgerichts vom 27. Mai 2020".
01.04.2021 18:49:51 [Tagesschau]
Obskure Investition in Mannheim: Der Rohbau und das Geld aus Baku
Aserbaidschan ist derzeit wieder in aller Munde, denn neben der kürzlich verstorbenen Bundestagsabgeordneten Karin Strenz standen oder stehen noch weitere Politiker im Verdacht, zumindest Lobbyarbeit für den kleinen aber wohlhabenden Kaukasusstaat zu betreiben, etwa der CDU-Bundestagsabgeordnete Axel Fischer, gegen den die Staatsanwaltschaft wegen eines Anfangsverdachts der Bestechlichkeit ermittelt.

Auch der nach einer Masken-Provisions-Affäre von allen Ämtern zurückgetreten ehemalige Mannheimer CDU-Bundestagsabgeordneter Nikolas Löbel war als engagierter Fürsprecher der deutsch-aserbaidschanischen Beziehungen aufgefallen.

02.04.2021 09:40:43 [Zeit Online]
Niederlande: Premier Mark Rutte übersteht Misstrauensvotum
Der niederländische Ministerpräsident Mark Rutte hat eine Vertrauensabstimmung im Parlament nur knapp überstanden. Nach einer langen und turbulenten Debatte über umstrittene Äußerungen von Rutte bei den Koalitionsgesprächen fehlte der Opposition in der Nacht zum Freitag in Den Haag am Ende die Mehrheit für ein Misstrauensvotum. Rutte hatte zuvor die Abgeordneten um Verzeihung gebeten. Das Parlament sprach aber mit großer Mehrheit seine tiefe Missbilligung für das Verhalten des Regierungschefs aus. Seine Glaubwürdigkeit sei ernsthaft beschädigt worden.
02.04.2021 12:12:47 [Telepolis]
"Grün-Schwarz" für Parteijugend ein "Schlag ins Gesicht"
Für die Grüne Jugend ist es mehr als eine Enttäuschung, dass ihre Mutterpartei in Baden-Württemberg nun doch wieder mit der CDU regieren will. "Diese Entscheidung ist ein Schlag ins Gesicht für alle, die in den letzten Monaten Wahlkampf für den Wechsel gemacht haben", erklärte die Bundessprecherin der Grünen Jugend, Anna Peters, am Donnerstagabend gegenüber Telepolis. Vor der Landtagswahl am 14. März hätten die Grünen in Baden-Württemberg "klar gesagt, dass sie sich eine Regierung ohne Union wünschen".

Die Entscheidung für eine Neuauflage der "grün-schwarzen" Koalition traf der Vorstand der Grünen im Ländle am Donnerstagabend erst im zweiten Anlauf.

02.04.2021 14:29:06 [ScienceFiles]
STIKO spielt mit der Gesundheit von unter 60jährigen
Die Saga um den Impfstoff von AstraZeneca nimmt in Deutschland immer skurrilere und immer gefährlichere Formen an. Die neueste Entwicklung sieht nun die Ständige Impfkommission (STIKO). Während die Verabreichung der zweiten Impfstoffdosis zum Ende des von der Zulassung gedeckten Zeitintervalls die Wirksamkeit nach der 2. Dosis erhöhen soll, ist die Wirksamkeit der 1. Dosis ausreichend, um das Intervall bis zu 12 Wochen abzudecken. Wie auch bei anderen Impfungen, tritt die Wirkung dieses Impfstoffs in der Regel etwa 10-14 Tage nach der ersten Impfstoffgabe ein.
02.04.2021 16:38:40 [RT DE]
Reiche Staaten behindern Produktion von Impfstoffen in Entwicklungsländern
Dem Leak zufolge wehren sich die reicheren Nationen unter Verweis auf Patentrechte dagegen, Entwicklungsländern bei der Fähigkeit zu unterstützen, eigene Impfstoffe herzustellen. Die reichen Länder sollen demnach Bestimmungen im internationalen Recht blockieren, die den Entwicklungsländern bei ihren Plänen helfen könnten. Bei dem Leak soll es sich um eine Kopie des Verhandlungstextes einer WHO-Resolution zu diesem Thema handeln, wie die BBC schreibt.

Zu den genannten reicheren Nationen sollen die EU-Staaten, Großbritannien und die USA gehören.

03.04.2021 06:48:53 [Junge Welt]
»Höchste Zeit, für Abrüstung auf die Straße zu gehen«
Gespräch mit Lühr Henken über die diesjährigen Ostermärsche, Kriegshetze und das nächste militärische Großprojekt der EU. Die Coronapandemie stellt auch die Ostermarschbewegung vor große Herausforderungen. Können die rund um dieses Wochenende geplanten Proteste trotzdem wie vorgesehen stattfinden?

Auf jeden Fall rufen die örtlichen Gruppen in rund 100 Orten zu Demonstrationen, Kundgebungen und Mahnwachen auf und sind entschlossen, diese – unter Einhaltung der Hygienemaßnahmen – unter freiem Himmel stattfinden zu lassen. Das sind etwa ebenso viele wie in den coronafreien Vorjahren.

03.04.2021 06:56:44 [Tichys Einblick]
Merkel täuschte bei Anne Will
Ein ZDF-Bericht machte öffentlich, dass das Bundeskanzleramt mehrere Tage vor dem AstraZeneca-Impfstopp bereits von den Risiken wusste. Die hielt man aber geheim und ließ einfach weiter impfen. Letzten Sonntag sitzt Merkel bei Anne Will, erläutert ihre Strategie, macht Druck auf die Ministerpräsidenten. Ihre Rolle: voll und ganz Mutti. ehrlich besorgte, die Kümmererin, die einzige, die nicht in Parteikategorien denkt, die einzige, auf die man sich verlassen kann. An diesem Abend gibt sie ein zentrales Versprechen ab: Man habe „für über 50 Millionen Menschen schon ein Impfangebot Ende des zweiten Quartals“. Einen Tag später wird der AstraZeneca-Stopp für unter 60-Jährige verhängt, der das Erreichen dieses Ziels in weite Ferne rückt.
03.04.2021 09:13:02 [Buchkomplizen]
Eskalation in der Ostukraine und bei Nord Stream 2
Kriegsschiffe, U-Boote und zivile Schiffe wollen Weiterbau der Pipeline behindern, russische Truppen wurden an die Grenze zur Ukraine verlegt, Nato und US-Präsident erklären Unterstützung für Kiew

Am Dienstag berichtete die Nato, dass am Montag zehnmal Kampfflugzeuge aufgestiegen seien, um russische Bomber und Kampfflugzeuge zu verfolgen, die in einem „ungewöhnlichen Peak an Flügen“ über den Nordatlantik, die Nordsee, das Schwarze Meer und die Ostsee geflogen seien. Man in weniger als sechs Stunden sechs Gruppen an russischen Militärflugzeugen „in der Nähe des Luftraums der Allianz“ abgefangen.

03.04.2021 13:19:04 [Junge Welt]
CDU in Thüringen: Maaßen strebt nach Mandat
Das sei doch sicher »ein ganz schlechter Aprilscherz«, twitterte Bundesarbeitsminister Hubertus Heil (SPD) am Donnerstag. Und der ehemalige CDU-Generalsekretär Ruprecht Polenz schrieb in dem Kurznachrichtendienst: »Der beste Aprilscherz ist heute der CDU Thüringen gelungen.« Beide bezogen sich auf eine Meldung, die für sie offenbar schwer zu begreifen war: Der südthüringische CDU-Kreisverband Schmalkalden-Meiningen will den Parteirechtsaußen und früheren Präsidenten des Bundesamtes für Verfassungsschutz, Hans-Georg Maaßen, als Kandidaten für die Bundestagswahl im September aufstellen.
03.04.2021 13:35:52 [Telepolis]
Mosambik: EU-Einsatz und Flüssiggas
Im Jahr 2010 stieg ein Konsortium unter heutiger Führung des französischen Total-Konzerns mit dem "Mosambik-Flüssiggasprojekt" groß in das dortige Land ein. Es geht dabei um die anvisierte Ausbeutung von 65 Billionen Kubikfuß Flüssiggas, wofür 2019 entschieden wurde, bis 2024 insgesamt 20 Milliarden US-Dollar investieren zu wollen. Im Juli vergangenen Jahres wurde bekanntgegeben, eine Vereinbarung für Investitionen im Umfang von 15 Milliarden US-Dollar sei unterzeichnet worden.

Kein Pappenstiel also, was man im Hinterkopf behalten sollte, wenn man nun Nachrichten wie Ende März im Deutschlandfunk liest.

03.04.2021 15:13:06 [Junge Welt]
»Zukunft Europas«: Rechtes Treffen in Budapest
Ungarns Ministerpräsident Viktor Orban, sein polnischer Amtskollege Mateusz Morawiecki und der frühere italienische Innenminister Matteo Salvini wollen ihre Zusammenarbeit ausbauen. Die drei rechten Politiker kündigten am Donnerstag nach einem Treffen in Budapest an, sich gemeinsam für eine »europäische Renaissance« einzusetzen. Man habe sich geeinigt, an der »Debatte um die Zukunft Europas« gemeinsam teilzunehmen und in den kommenden Wochen diesbezüglich ein Programm auszuarbeiten, sagte Orban. Das berichtete die ungarische Nachrichtenagentur MTI.

Ungarns Ministerpräsident hatte die beiden Politiker nach Budapest eingeladen, nachdem seine Partei Fidesz Mitte März die Europäische Volkspartei (EVP) verlassen hatte.

04.04.2021 07:15:59 [Buchkomplizen]
Nawalny im Hungerstreik: Exitstrategie?
Mit dem Hungerstreik sollen auch neue Proteste organisiert und Aufmerksamkeit gescchaffen werden. Möglicherweise verfolgen Nawalny und seine Mitarbeiter ein Drehbuch.

Alexei Nawalny, der in der Strafkolonie Pokrovskaya IK-2 inhaftiert ist, hat am Dienstag angekündigt, in einen Hungerstreik zu treten, allerdings in abgemildeter Form, weil er weiterhin Flüssigkeit zu sich nehmen will. Er protestiert dagegen, dass er nicht ausreichend wegen seiner Rückenschmerzen und Lähmungserscheinungen in einem Bein medizinisch behandelt wird, nicht von einem Arzt besucht werden kann und unter Schlafentzug leidet, weil er angeblich wegen Fluchtgefahr achtmal in der Nacht geweckt wird, was einer psychischen Folter gleich käme.

04.04.2021 09:29:50 [Zeit Online]
Hunderte Teilnehmer bei Ostermärschen
In ganz Deutschland haben mehrere hundert Menschen an Ostermärschen teilgenommen. Bei den traditionellen Protesten forderten die Demonstranten mehr Frieden in der Welt – etwa durch die Abschaffung von Atomwaffen oder von Kampfdrohnen bei Kriegseinsätzen. In diesem Jahr lautete eine Kernforderung die Abkehr von der Zwei-Prozent-Vorgabe der Nato. Die Bündnismitglieder – darunter Deutschland – haben sich gemäß dieser Vorgabe verpflichtet, zwei Prozent ihres Bruttoinlandsprodukts für Verteidigung auszugeben.
04.04.2021 09:36:53 [Tichys Einblick]
Medien dramatisieren Telefon-Aktion zur Stuttgarter Demo
Einige Medien bauschen offenbar eine Telefon-Aktion auf. Laut Presseberichten erhielten Tausende Menschen aus dem Raum Stuttgart am Karfreitag einen automatisierten Anruf. Dabei forderte eine Computerstimme auf, an der Demo am Samstag teilzunehmen. Wer hinter der Aktion steckt, ist unklar. Medien brachten aber den Stuttgarter Ableger von Querdenken mit den anonymen Anrufen in Verbindung.

Etwa schreibt t-online, die Anrufe würden gegen geltendes Recht verstoßen. Eine konkrete Rechtsnorm nennt das Medium aber nicht, das offenbar zuerst über die Aktion berichtete. Laut dem Spiegel “belästigten” Unbekannte die Bürger mit Anrufen, die “illegal” seien.

04.04.2021 11:28:50 [Neues Deutschland]
»Querdenker«-Demo: Aufstand des deutschen Spießbürgers in Stuttgart
Mehr als 10.000 Menschen der »Querdenken«-Bewegung demonstrieren am Karsamstag in der Landeshauptstadt Baden-Württembergs. Die Stuttgarter Innenstadt ist an diesem Karsamstag nicht wiederzuerkennen. Von etwa 2.500 Teilnehmenden waren die Sicherheitsbehörden ausgegangen. Gekommen sind laut Agenturangaben mehr als 10.000 Menschen. Schon am Vormittag ist der Marienplatz brechend voll. Maskenpflicht? Mindestabstand? Fehlanzeige. Auf Nachfrage sagt ein Polizeisprecher, man wolle die Demo »deeskalierend begleiten«. Setze man jedem Teilnehmer eine Maske auf, würde dies zu »unmittelbarem Zwang« und möglichen polizeilichen Maßnahmen führen – womit sich der Aerosol-Ausstoß noch verstärken würde. Man kann wohl sagen: alles wie immer.
04.04.2021 13:15:44 [Tichys Einblick]
„Querdenker“ Stuttgart: Mit Love und Peace für Freiheit und gegen Merkel
Die Stuttgarter Medien hatten mobil gemacht: Die sogenannten „Querdenker“ demonstrieren. Die „Corona-Leugner“ werden vom Landesamt für Verfassungsschutz beobachtet. „Rechtsradikale” „Reichsbürger” treffen auf „rechtspopulistische” AfD-Mitglieder. Das Gesundheitsministerium ist „besorgt”. Es werden „Gewalttätigkeiten” erwartet. Die Polizei hat sich am Samstagvormittag mit einigen Hundert Beamten für mehrere Demonstrationen gegen die Corona-Auflagen und geplante Gegenproteste in Stuttgart aufgestellt. Es wird mit Einsatz von Wasserwerfern und Tränengas gerechnet.

Alles wurde geschrieben, um die Leute in Angst zu versetzen und so davon abzuhalten, zum Cannstatter Wasen aufzubrechen.

04.04.2021 15:22:09 [Golem]
Daten von 500 Millionen Facebook-Nutzern geleakt
In einem Hackerforum ist eine Datenbank mit Details zu rund 533 Millionen Facebook-Nutzern aus weltweit 106 Ländern angeboten worden. Die Daten enthielten neben den Namen der Nutzer noch die Mobilfunknummer, einige E-Mails, Geschlecht, Beruf, Stadt, Land und Beziehungsstatus, schrieb der Nutzer, der über seinen Telegram-Account kontaktiert werden konnte. Der Liste in seinem Beitrag zufolge verfügt er über die Daten von 6,05 Millionen Nutzern aus Deutschland sowie 1,25 Millionen aus Österreich und 1,59 Millionen aus der Schweiz. Im Januar 2021 war der Zugriff auf die Datenbank bereits über einen Bot angeboten worden.
05.04.2021 09:48:37 [Heise]
Verwirrung um Widerrufsrecht für "Bestell und hol ab"-Geschäfte
In Zeiten des Lockdowns bieten lokale Händler oft eine Online-Kaufanbahnung. Ein Widerrufsrecht gibt es dabei aber nur, wenn Händler es freiwillig einräumen. Not macht erfinderisch. So entdeckt der stationäre Handel, gebeutelt durch die Einschränkungen im Zuge von Lockdown-Maßnahmen, verstärkt das Internet. Allerdings hat das Betreiben eines eigenen Online-Shops seine ganz eigenen Bedingungen und Tücken. Nicht zuletzt gehören dazu die verbraucherfreundlichen Regelungen für Fernabsatzgeschäfte. Es geht insbesondere um das 14-tägige begründungslose Widerrufsrecht bei Käufen, das man einräumen und über das man auch noch auf pingeligst vorgeschriebene Weise informieren muss.
05.04.2021 09:52:44 [WSWS]
Russland-Ukraine-Konflikt
In den letzten Wochen sind die Kämpfe zwischen dem ukrainischen Militär und den von Russland unterstützten Separatisten in der Region Donbass deutlich eskaliert. Während die westlichen Medien über die angebliche „Aggression Russlands“ zetern, spielen sich die militärischen Zusammenstöße tatsächlich vor dem Hintergrund einer Reihe von schweren Provokationen der ukrainischen Regierung ab. Sie rechnet damit, in einem möglichen Krieg mit Russland von der Nato unterstützt zu werden.

Die Spannungen zwischen Russland und der Ukraine sind mittlerweile so scharf wie noch nie seit dem rechtsextremen Staatsstreich vom Februar 2014, der von den USA und Deutschland unterstützt wurde und zur Absetzung der Regierung von Viktor Janukowitsch führte.

05.04.2021 14:08:46 [Infosperber]
Leise Hoffnung auf Deeskalation zwischen USA und Iran
Gibt es einen Weg zur Deeskalation der seit drei Jahren gefährlich wachsenden Konfrontation zwischen den USA und Iran und damit eine Chance für die Rückkehr beider Staaten in das Abkommen zur Begrenzung von Teherans Nuklearprogramm auf nichtmilitärische Zwecke? Leise Hoffnung macht das für Dienstag in Wien geplante erste Treffen von Regierungsvertretern aller sieben ursprünglichen Vertragsstaaten. Das im Juli 2015 geschlossene Abkommen wurde unter Ex-Präsident Donald Trump im Mai 2018 einseitig aufgekündigt. Seit diesem Ausstieg hatte die Trump-Administration eine Strategie «massiven Drucks» gegen Teheran verfolgt.
05.04.2021 16:05:31 [Telepolis]
Redeblumen vor Ostern und zu Ostern
Wie uns die Word-Spreader Spahn und Wieler vor den Feiertagen noch einmal Pandemie und Maßnahmen erklärt haben. Was wird uns vor Corona retten? In der live über verschiedene Kanäle verbreiteten Pressekonferenz des Robert-Koch-Instituts (RKI) vom 26. März ("Spahn und RKI-Chef Wieler zur Corona-Lage vor Ostern und zu Ostern") gaben zwei Spezialisten ein seltsames postmodernes Stelldichein vor einer Riege überforderter Journalisten, die wie ahnungslos vor den hohen Autoritäten hockten. Und die nicht gerade standesgemäß den Repräsentanten der "Wissenselite" huldigten.
05.04.2021 17:14:29 [Telepolis]
Grönland und die Interessen der Anderen
Grönland wählt am morgigen Dienstag eine neue Regierung und die Abstimmung wird international interessiert beobachtet werden, wenn auch aus jeweils unterschiedlichen Gründen. Die Grönländer selbst mögen vor allem an einem selbstbestimmten, guten Leben interessiert sein. Die geografische Schlüsselstellung des Landes in der Arktis, wo die Großmächte aufeinandertreffen, kann dabei sowohl helfen als auch hindern.

Eine Mercatorkarte ist missweisend, wenn es um die arktischen Verhältnisse geht. Eine Polkarte oder die Globusansicht von Google Earth zeigen deutlicher, wo die militärischen und/oder ökonomischen Interessen der arktischen Staaten aufeinanderstoßen. Im Folgenden eine Aufklärung.

05.04.2021 19:08:37 [Telepolis]
Die Fake-Freiheiten des Jens Spahn
Gesundheitsminister kündigt Privilegien für Geimpfte an. Oder geht es um Rückgabe von Grundrechten? Und wie ist das alles eigentlich umsetzbar? Einige Fragen: Diese Entwicklung war absehbar: Bundesgesundheitsminister Jen Spahn (CDU) hat in einem Interview mit der Bild am Sonntag Menschen mehr Rechte in Aussicht gestellt, sollten sie vollständig gegen den neuartigen Corona-Virus Sars-CoV-2 geimpft sein.

Der Vorstoß sorgte am Osterwochenende erwartungsgemäß für Furore: Die einen begrüßten den Ansatz, während er von anderen als nicht umsetzbar oder gar ungerecht zurückgewiesen wurde.

06.04.2021 07:02:59 [Junge Welt]
Säbelrasseln in Frontnähe: Konflikt um Donbass
Die Lage im Donbass hat sich in den vergangenen Wochen ohne Zweifel verschärft. Ukrainische Militärs drohen, sie warteten nur auf den Befehl zur Offensive auf die seit 2014 von Kiew abgespaltenen Volksrepubliken. Der Staatschef der VR Donezk, Denis Puschilin, spricht von einem unmittelbar bevorstehenden ukrainischen Angriff. Dazu verweist die Ukraine auf russische Truppenbewegungen entlang ihrer östlichen und – das ist neu – nördlichen Grenze, das heißt: in Belarus. Und der Kremlsprecher bestreitet Truppenbewegungen gar nicht, sondern sagt, Russland könne seine Truppen auf eigenem Gebiet verlegen, wie es wolle. Geht der Krieg um den Donbass bald in die nächste Runde?
06.04.2021 09:37:14 [Junge Welt]
Ostermärsche in der Pandemie: Erfolg für Friedensbewegte
Mit einem vehementen Aufruf für Abrüstung und Frieden sind die diesjährigen Ostermärsche zu Ende gegangen. Die traditionellen Proteste der Friedensbewegung standen zum zweiten Mal in Folge unter dem Eindruck der Coronapandemie. Trotz der Beschränkungen des Versammlungsrechtes, zu dem es mancherorts aufgrund steigender Infektionszahlen mit dem gefährlichen Virus gekommen war, zog das »Netzwerk Friedenskooperative« in einer am Montag veröffentlichten ersten Stellungnahme »eine positive Bilanz« der Ostermärsche. In mehr als 100 Städten hätten über Ostern Aktionen für Frieden, Abrüstung und Gerechtigkeit stattgefunden.
06.04.2021 11:24:30 [Süddeutsche Zeitung]
Maskenaffäre: Bayerns Justiz greift sich 470.000 Euro aus Sauters Maskendeals
Bayerns Landesjustizkasse verzeichnet in diesen Tagen einen ungewöhnlichen Geldeingang. Eine gemeinnützige Bürgerstiftung im schwäbischen Günzburg hat 469.178,92 Euro auf das Justizkonto bei der Bayerischen Landesbank überwiesen. Verwendungszweck: 38/HL 336/21. Das Kürzel steht für die Affäre um Geschäfte von Unionspolitikern mit Corona-Schutzmasken. Genauer gesagt: Für jenen Teil der Affäre, in die der CSU-Politiker und Landtagsabgeordnete Alfred Sauter verwickelt ist.

Die Bürgerstiftung, die viel Gutes tut (Soziales, Bildung und mehr) und über jeden Zweifel erhaben ist, hat mit der Affäre nicht das Geringste zu tun. Die Stiftung war vielmehr unverhofft zu dem vielen Geld gekommen.

06.04.2021 11:29:07 [Telepolis]
EU-Hilfen für Syrien: Der scheinheilige deutsche Außenminister
Der deutsche Außenminister Heiko Maas beklagt in der Welt zu Recht die Menschenrechtsverletzungen der Assad-Regierung gegen die syrische Bevölkerung. Die Menschenrechtsverletzungen der Türkei und ihrer islamistischen Verbündeten in Nordsyrien verschweigt Maas jedoch.

Er verspricht Hilfe für die syrischen Menschenrechtsaktivisten und die Zivilbevölkerung, die unter dem Regime leiden. Davon merkt man in Nordsyrien leider nichts. Die Menschen in dieser Region bleiben sich selbst überlassen, ihre Situation blendet er aus.

06.04.2021 14:55:14 [RT DE]
Russland: Kiew will westliche Ukraine-Politik als Blankovollmacht nutzen
Eine Sprecherin des französischen Außenministeriums und ein Sprecher des Auswärtigen Amtes sagten in einer gemeinsamen Erklärung vom 3. April, beide Staaten seien über die Lage in der Ostukraine besorgt. Man beobachte die Situation, "insbesondere die Bewegungen russischer Truppen, sehr aufmerksam" und rufe die Parteien zur Zurückhaltung und sofortigen Deeskalation auf. Zudem unterstrichen die Regierungen in Berlin und Paris erneut ihre Unterstützung für die Souveränität und die territoriale Integrität der Ukraine in ihren international anerkannten Grenzen. Der Leiter des Komitees für internationale Angelegenheiten im Russischen Föderationsrat, Konstantin Kossatschow, kritisierte daraufhin die westliche Politik des Schweigens.
06.04.2021 16:50:13 [Buchkomplizen]
Konflikt esakaliert zwischen der vom Westen vorbehaltlos unterstützten Ukraine und Russland
Mit zunehmender Spannung zwischen der Ukraine und Russland hat die Nato schnell die Ukraine zum ersten Partnerstaat zum LANDCOM der NATO Response Force (NRF) gemacht. Das ist zwar nur ein weiterer Schritt, die Ukraine faktisch in die Nato zu integrieren. 2020 wurde die Ukraine bereits zum zu einem Enhanced Opportunity Partner, wie dies Australien, Finnland, Georgien, Jordanien und Schweden bereits sind, was auch darauf hinweist, wie das einst transatlantische Bündnis seine militärische Einflusssphäre ausdehnen will. LANDCOM macht auch mit der Meldung klar: „We are Nato“. Die Ukraine würde gerne gemeinsame Militärübungen ausführen, was die „Sicherheitssituation“ stabilisieren würde.
07.04.2021 06:43:50 [Telepolis]
EU-Spitze wegen Treffen mit Erdogan in der Kritik
Die Treffen von EU-Kommissionspräsidentin Ursula von der Leyen und EU-Ratspräsident Michel mit dem türkischen Präsidenten Recep Tayyip Erdogan stößt bei Oppositionspolitikern im Bundestag wie im Europaparlament auf Kritik.

Der FDP-Fraktionsvize im Bundestag, Alexander Graf Lambsdorff, hält es für ein "falsches Signal" und den Zeitpunkt für unpassend, um die "Politik des türkischen Staatspräsidenten Erdogan mit PR-kräftigen Bildern zu belohnen", kurz nachdem die Türkei aus der Istanbul-Konvention zum Schutz von Frauen ausgetreten ist. Auch die Arbeit von Presse und Opposition werde dort massiv behindert, erinnerte Lambsdorff am Dienstag.

07.04.2021 09:15:12 [Junge Welt]
Kanzlerkandidatur CDU/CSU: Auf den Spuren von Strauß
Das Kandidatenfeld im Rennen um die Kanzlerkandidatur der Union biegt auf die Zielgerade. Und es ist nicht CDU-Chef Armin Laschet, der vorneweg läuft. »Zwischen Ostern und Pfingsten« wollten Laschet und der CSU-Vorsitzende Markus Söder klären, wer von beiden für die Union bei der Bundestagswahl im September Anspruch auf das Kanzleramt erhebt. Jetzt, kurz vor der Entscheidung, machen die Freunde Söders in der CDU eine neue Front auf: Warum, fragen sie, entscheidet eigentlich nicht die Bundestagsfraktion über den Kandidaten? Eine so wichtige Entscheidung müsse eigentlich über ein Votum der Mitglieder erfolgen, sagte der CDU-Abgeordnete Michael von Abercron dem "Spiegel".
07.04.2021 09:26:32 [RT DE]
Donbass-Konflikt: Was bedeuten die neuen Drohgebärden?
Es war nur ein knapper Tweet, und doch erregte er viel Aufmerksamkeit. Der EU-Außenbeauftragte Josep Borrell sprach mit dem ukrainischen Außenminister Dmytro Kuleba und sagte dem Land die unerschütterliche Unterstützung zu. "Mit großer Sorge [verfolgen wir] die russischen militärischen Aktivitäten rund um die Ukraine." Ursache für diesen Tweet waren wohl die Worte des ukrainischen Generalstabschefs Ruslan Chomtschak. Dieser hatte vor gut einer Woche im Parlament in Kiew erklärt, Russland habe an der Grenze zur Ukraine massiv Truppen zusammengezogen. Kommt jetzt die Invasion, vor der die Ukraine so lange gewarnt hat?
Der Kreml bestreitet dies.

07.04.2021 13:20:00 [Junge Welt]
Konflikt im Donbass: Krieg und Nervenkrieg
Russland und Ukraine beschuldigen sich gegenseitig, neue militärische Konfrontation um Donbass vorzubereiten. Die westlichen Alliierten der Ukraine haben dieser in der Auseinandersetzung um den Donbass zumindest politisch den Rücken gestärkt. In einer Reihe von Telefongesprächen zwischen Präsident Wolodimir Selenskij und den Regierungen in Washington, Paris, London und Berlin äußerten deren Chefs mehr oder minder gleichlautend ihre »Besorgnis« über russische Truppenbewegungen nahe der Grenze zur Ukraine und auf der Krim und forderten von Moskau »Deeskalationsschritte«. Auch ein NATO-Sprecher stimmte in den Chor ein.
07.04.2021 14:56:37 [Lost in EUrope]
Türkei-Politik: “Merkel hat Druck gemacht”
Wie konnte es zum erneuten Kniefall der EU vor dem islamischen Regime in der Türkei kommen? Zwei ehemalige Botschafter packen aus – und belasten Kanzlerin Merkel.

“Merkel hat großen Druck gemacht“, sagt der ehemalige EU-Botschafter in der Türkei, Marc Pierini. Sie werde, wie die meisten EU-Politiker, von der “absoluten Angst” getrieben, dass Sultan Erdogan die Grenzen wieder aufmachen und tausende Flüchtlinge nach EUropa schicken könnte.

Merkel wolle und könne es sich nicht erlauben, ihre Amtszeit mit einer Krise mit der Türkei zu beenden, so Pierini im Pariser “Figaro”. Dies deckt sich mit meiner Analyse: Der neue “Deal”, den die EU-Spitzen anstreben, muß bis zur Bundestagswahl unter Dach und Fach sein!

07.04.2021 16:23:09 [Heise]
RKI will keine Veröffentlichung von Geimpften-Studie
Das bundeseigene Institut will nicht, dass die Zusammenfassung von Erkenntnissen zum Übertragungsrisiko durch vollständig geimpfte Personen veröffentlicht wird. Wer vollständig geimpft wurde, könne in Zukunft wie jemand behandelt werden, "der negativ getestet wurde", sagte Bundesgesundheitsminister Jens Spahn (CDU) zu Ostern via Bild am Sonntag. Zudem müssten nach Einschätzung des Robert-Koch-Instituts (RKI) vollständig Geimpfte auch nicht mehr in Quarantäne. Man werde diese Erkenntnisse nun zeitnah in Gesprächen mit den Ländern in die Praxis bringen, sagte Spahn der Zeitung.
08.04.2021 07:15:09 [Süddeutsche Zeitung]
Historischer Machtwechsel in Grönland
Nur 56 000 Einwohner, aber im Visier der Großmächte: Wie schmelzendes Eis, Uran und Seltene Erden den Sozialisten einen Wahlsieg brachten. Grönland steht vor einem Machtwechsel, dessen Bedeutung auch in Washington und in Peking genau studiert werden wird. Zum zweiten Mal erst seit Gewährung der Selbstverwaltung durch Dänemark 1979 müssen die bislang regierenden Sozialdemokraten von der Partei Siumut wohl in die Opposition. Sie kamen auf 29,4 Prozent der Stimmen. Wahlsieger ist mit 36,6 Prozent der Stimmen die sozialistische IA (Inuit Ataqatigiit), deren 34-jähriger Vorsitzender Múte Bourop Egede nun das Recht hat, sich an der Regierungsbildung zu versuchen.
08.04.2021 09:34:02 [Junge Welt]
Georgisches Szenario: Ukraine und NATO-Mitgliedschaft
Geschichte wiederholt sich nie genau, aber in groben Zügen manchmal schon. Die Situation rund um die Ukraine erinnert in fataler Weise an die Spannungen, die Georgiens damaliger prowestlicher Präsident Micheil Saakaschwili 2008 um Südossetien und Abchasien anzettelte. Er war sich aufgrund vollmundiger Worte US-amerikanischer Unterstützung sicher, dass er ohne größeres Risiko sein nationales Süppchen würde kochen können: Regionen, die sich nach dem Ende der UdSSR von Georgien abgespalten hatten, heim zu holen. Die Realität sah bekanntlich anders aus: Als georgischer Beschuss russische Friedenstruppen traf, nahm Moskau das zum Anlass, militärisch zu intervenieren.
08.04.2021 13:26:47 [Tichys Einblick]
Wie Merkel jetzt alle Corona-Macht ins Kanzleramt katapultieren will
Merkel unterstützt Laschets Forderung nach einem harten Lockdown – der Himmel ist blau, der Papst ist katholisch. Jede Forderung nach einem „kurzen, einheitlichen Lockdown“ sei nämlich richtig, ließ die Kanzlerin am Dienstag über eine Regierungssprecherin mitteilen. Es gehe um gemeinsames Handeln: „Die Vielfalt der beschlossenen Regeln trägt im Moment nicht zur Sicherheit und zur Akzeptanz bei“. Als ob es die Unterschiede zwischen Bremen und Bayern wären, die die Leute lockdownmüde machen – wieder einmal sind die Corona-Spindoktoren fleißig am Werk. Und „gemeinsam” ist Machtsemantik für „einheitlich”, wie es „solidarisch” für „gehorsam” ist.
08.04.2021 15:01:03 [Telepolis]
Grönland stimmt gegen Bergbauprojekt Kuannersuit
Es gibt in Grönland keine Mehrheit für das Bergbauprojekt Kuannersuit/Kvanefjeld. Das darf man nach der Wahl am 6. April sicher behaupten.

Das klare Nein zur Kuannersuit machte die linke Partei Inuit Ataqatigiit mit 36,6 Prozent zur größten Fraktion im Landesparlament (Inatsisartut). Gemeinsam mit kleinen Parteien, die ebenfalls kritisch eingestellt sind, haben sie damit die Mehrheit, das umstrittene Projekt abzulehnen. In Kuannersuit sollen Seltene Erden und Uran abgebaut werden. Das Vorhaben befindet sich in der Genehmigungsphase und war in der öffentlichen Diskussion zuletzt das heißeste Thema überhaupt.

08.04.2021 17:09:12 [Telepolis]
CDU hadert mit Rechtsausleger Maaßen
Ist der ehemalige Chef des deutschen Inlandsgeheimdienstes zu rechts, um mit dem Ticket der CDU in den Bundestag einzuziehen? - Einige Christdemokraten haben durchaus Bedenken gegen die geplante Kandidatur von Hans-Georg Maaßen in Südthüringen. Die vier beteiligten Kreisverbände halten aber offenbar mehrheitlich daran fest. Nach einem Treffen mit Vertretern der Kreisverbände am Mittwochabend sagte CDU-Landeschef Christian Hirte dem Redaktionsnetzwerk Deutschland (RND), die Wortbeiträge in den Beratungen seien "60 zu 40 pro Maaßen" ausgefallen.
08.04.2021 18:49:10 [Zeit Online]
Öbag-Chef Thomas Schmid: Die Ballhausplatz-Boys
Sebastian Kurz hatte einen "neuen Stil" angekündigt, er wollte dem Postenschacher ein Ende setzen. Die jüngste Affäre um Thomas Schmid zeigt aber: Das war ein leeres Versprechen. Am Dienstagnachmittag ist der Traum von Thomas Schmid zerplatzt. Jahrelang hatte sich der ehemalige Generalsekretär im Finanzministerium für den Vorstandsjob bei der Österreichischen Beteiligungs AG (Öbag) ins Zeug gelegt, sich das Vertrauen des Kanzlers erarbeitet, sich um Stellen für joblose Parteifreunde bemüht und dabei sehr viele Textnachrichten geschrieben.
09.04.2021 06:51:21 [Junge Welt]
Altmaier unter Druck
Bundeswirtschaftsminister Peter Altmaier (CDU) hat am Donnerstag mehr als 40 Verbände zu virtuellen Gesprächen über die Lage der Firmen in der Coronakrise eingeladen. Neben dem Mittelstand und den Familienunternehmen waren auch Selbständige und Vertreter aus den Branchen Handel, Logistik, Entsorgung, Gastronomie und Tourismus dabei. Es wurde über »drängende Probleme« gesprochen, darunter das Testen auf Infektionen in den Betrieben.

Der Handelsverband Deutschland (HDE) forderte auf dem Wirtschaftsgipfel, die »weiterhin desaströse Lage im zwangsgeschlossenen Einzelhandel und die Dringlichkeit für Anpassungen bei den Coronahilfen« anzuerkennen.

09.04.2021 09:08:01 [Telepolis]
Hoher Kreml-Beamter sieht "Anfang vom Ende der Ukraine"
Am Donnerstag kam eine Warnung aus dem Kreml, wie sie es seit der heißen Kriegsphase 2014/15 nicht mehr gegeben hatte. Wenn Kiew militärische Handlungen im großen Maßstab im Donbass beginne, dann sei das "der Anfang vom Ende" der Ukraine, erklärte Dmitri Kosak, stellvertretender Leiter der russischen Präsidialverwaltung, gegenüber der Zeitung Kommersant.

Zum Aufgabenbereich Kosaks gehören die ehemaligen sowjetischen Nachbarrepubliken. Wenn die Ukraine einen Großangriff auf die Volksrepubliken starte, dann sei das "kein Schuss ins Bein, sondern in die Schläfe".

09.04.2021 14:40:15 [Buchkomplizen]
Putin und Merkel sprachen über den Ukraine-Konflikt – wirklich?
In und um die Ukraine schwappt derzeit eine Flut von Gerüchten, Desinformationen und Propaganda. Kiew und die Volksrepubliken melden jeweils nur die Angriffe der anderen Partei und sprechen von Eskalation, die diese verursache. Jeweils der anderen Seite werden auch Verletzungen des Waffenstillstands und des Minsker Abkommens vorgeworfen, wie das schon seit Jahren der Fall ist. Man selbst macht nichts, reagiert höchstens.

Von daher ist mit Skepsis zu sehen, wenn der ukrainische Außenminister Dmytro Kuleba behauptet, das ukrainische Militär schießen nur, wenn der Feind angreift.

09.04.2021 14:45:20 [Tichys Einblick]
Föderalismus ausgehebelt: Bundesländer stimmen ihrer Entmachtung zu
Die für Montag angesetzte Ministerpräsidentenkonferenz ist abgesagt. „Es wird in der kommenden Woche gar keine Ministerpräsidentenkonferenz stattfinden“ teilte die stellvertretende Regierungssprecherin Ulrike Demmer am Freitag in der Bundespressekonferenz mit. Ob sie danach noch folgen soll oder ganz ausfällt, ist bis dato noch unklar.

Schon in der kommenden Woche wolle die Bundesregierung eine Änderung des Infektionsschutzgesetzes auf den Weg bringen, die die Rechte des Bundes deutlich stärke. Dieser Plan werde – das ist die entscheidende Nachricht – im Einvernehmen mit den Bundesländern verfolgt.

09.04.2021 14:52:56 [Telepolis]
Gesundheitsministerium drängt Länder auf Privilegien für Geimpfte
Nachdem der Präsident des Robert-Koch-Instituts (RKI), Lothar Wieler, in einer Kurzinformation an das Bundesgesundheitsministerium von einer grundsätzlich geringeren Virusübertragung durch Personen ausgegangen ist, die vollständig gegen das neuartige Corona-Virus Sars-CoV-2 geimpft wurden, drängt das Ministerium nun auf Privilegien für diese Personengruppe.

Das geht aus einer Empfehlung des Hauses an die Gesundheitsminister der Länder hervor, die "Telepolis" vorliegt. Zuerst hatte die Nachrichtenagentur dpa am Mittwoch über das Schreiben berichtet.

09.04.2021 17:18:54 [Golem]
Neues Datenleck bei Corona-Testzentren
Wieder hat es ein Datenleck bei einem Anbieter von Corona-Schnelltests gegeben. Entdeckt wurde die Sicherheitslücke erneut von der Projektgruppe Zerforschung. Demnach waren Daten wie Name, Adresse, Geburtsdatum, Telefonnummer, E-Mail-Adresse, Testdatum und Testergebnisse von Tausenden Personen abrufbar. Allein in Berlin und Hamburg waren jeweils rund 3.000 Datensätze abrufbar, in Leipzig gar 3.100. Insgesamt konnten am 6. April über 14.000 Tests von 10 Testzentren in verschiedenen Städten über die Webseite testcenter-corona.de abgerufen werden.
09.04.2021 18:59:32 [Telepolis]
Grünes "Jein" zu Ceta: Foodwatch fordert Klarheit
Die Verbraucherschutz-Organisation foodwatch warnt Mitglieder der Grünen vor einer "180-Grad-Wende" in der Handelspolitik und fordert sie auf, vor dem Parteitag im Juni einen Änderungsantrag für das Bundestagswahlprogramm einzubringen. Hintergrund sind Aussagen zum europäisch-kanadischen Freihandelsabkommen Ceta im Programmentwurf des Bundesvorstands der Grünen.

Darin gibt es zwar noch "erhebliche Kritik" an Ceta, aber kein klares "Nein" mehr. "Wir wollen daher das Ceta-Abkommen in seiner derzeitigen Fassung nicht ratifizieren, sondern es bei der Anwendung der derzeit geltenden Teile belassen", heißt es in dem Entwurf.

10.04.2021 08:55:50 [Junge Welt]
Konflikt in Nordirland: Druck im Kessel
Die Molotowcocktails fliegen in Nordirland dieser Tage wieder tief. Seit dem Wochenende kommt es täglich zu Ausschreitungen in protestantischen Gegenden. Kleine Gruppen von Jugendlichen konfrontieren die Polizei und werfen Brandbomben. Anscheinend wurden sie in Marsch gesetzt von paramilitärischen unionistisch-loyalistischen Gruppen, die teilweise in Verbindung mit kriminellen Kreisen stehen. In der Nacht von Mittwoch zu Donnerstag zündeten Jugendliche in Belfast einen Bus im Grenzgebiet zwischen unionistischen/ protestantischen und republikanischen/katholischen Straßenzügen an.
10.04.2021 11:13:42 [Zeit Online]
Deutsche Corona-Politik: Genug gegipfelt
Die Absage des Bund-Länder-Treffens ist das Eingeständnis eines Scheiterns. Das oberste Corona-Gremium hat sich selbst diskreditiert. Nun will der Bund mehr Kompetenzen. Die letzte Runde im März endete in einem Desaster. Bis tief in die Nacht hatten die Kanzlerin und die Ministerpräsidenten gestritten. Sie beschlossen mit der sogenannten Osterruhe schließlich wenig – und das mussten sie dann auch noch keine 48 Stunden später wieder ersatzlos zurücknehmen. Das Echo war verheerend: Die politische Elite hatte Vertrauen verspielt und in der Bekämpfung der Pandemie nichts erreicht.
10.04.2021 11:29:16 [Tichys Einblick]
Merkels Entwurf für den Bundeslockdown
Ausgangssperren, Schulschließungen, Einzelhandel dicht. Es ist ein Schlag: Am Freitagmorgen gibt eine Regierungssprecherin nicht nur bekannt, dass die Bundesregierung daran arbeite, die Corona-Maßnahmen bundesweit einheitlich zu regeln – es heißt auch, die Bundesländer seien damit einverstanden. Und das scheint auch wirklich zu stimmen: Zwar sind einige Länderchefs wie Reiner Haseloff aus Sachsen-Anhalt skeptisch; andere wie Markus Söder wirken regelrecht froh darüber, dass der Föderalismus ausgehebelt wird. Merkel hat die Landesregierungen in den letzten Tagen intensiv bearbeitet – jetzt soll sie eine Mehrheit der Ministerpräsidenten hinter sich haben.
10.04.2021 15:04:12 [Heise]
Mitarbeiter stimmen gegen erste US-Gewerkschaft bei Amazon
Der weltgrößte Onlinehändler Amazon hat die mit Spannung verfolgte Abstimmung über die erste Gewerkschaft an einem US-Standort gewonnen. Auch wenn die Auszählung noch andauerte, war am Freitag bereits klar, dass die Mehrheit der Beschäftigten in Bessemer im Bundesstaat Alabama sich gegen die Arbeitnehmervertretung entschieden hat. Mindestens 1608 von insgesamt 3215 abgegebenen Stimmen waren gegen den Anschluss an die Handelsgewerkschaft RWDSU. Sollte das Resultat nicht gekippt werden, so hätte der Konzern von Multimilliardär Jeff Bezos die historische Wahl für sich entschieden und den ersten Durchbruch einer US-Arbeitnehmervertretung in seiner rund 27-jährigen Geschichte verhindert.
10.04.2021 15:27:54 [Telepolis]
Griechenland: Die Ermordung eines Journalisten und viele mögliche Motive
Der griechische Journalist und Blogger Giorgos Karaivaz wurde am Freitag kurz nach 14 Uhr in Alimos, einem Vorort von Athen auf offener Straße erschossen. Seit Jahrzehnten war er einer der führenden Kriminalreporter des Landes. Abseits seiner, seit den neunziger Jahren intensiven Tätigkeit für das griechische Fernsehen betrieb er mit dem bloko.gr als Herausgeber und Chefradakteur ein Internetmagazin, das sich auf den Themenkomplex Polizei und Kriminalität in Griechenland spezialisiert hat. Für alle Beobachter in Griechenland steht außer Frage, dass Karaivaz im Zusammenhang mit seiner Arbeit ermordet wurde. Sein Tod wirft Fragen auf.
10.04.2021 19:03:43 [Egon W. Kreutzer]
Wo bleiben die Verfassungsrechtler?
Die nun offenbar unbedingt gewollten Änderungen des Infektionsschutzgesetzes, die ja noch tiefer in die Verfassung eingreifen, weil nicht nur die Länder Rechte und Zuständigkeiten verlieren, sondern auch der parlamentarische Prozess im Bundestag zu Gunsten der Erweiterung der Machtfülle der Regierung ausgehebelt wird, indem der Regierung gestattet werden soll, mit Notverordnungen ein Recht zu setzen, dass in Demokratien nur als „absolutistische Willkür“ bezeichnet werden kann, stellen mich vor die Frage, ob dies mit einem einfachen Bundesgesetz und der Zustimmung der Länder im Bundesrat, jedoch ohne die geradezu zwingend erscheinende Grundgesetzänderung, überhaupt Rechtskraft erhalten kann.
11.04.2021 11:36:13 [Tichys Einblick]
Zu Merkels Lockdown dramatisiert die Tagesschau die Fakten
Die Tagesschau veröffentlicht regelmäßig eine Deutschlandkarte, die die 7-Tage-Inzidenz für jeden Landkreis ausweist – je dunkler ein Kreis eingefärbt, desto mehr gemeldete Corona-Neuinfektionen gibt es dort. Im Falle dieser Karte sind niedrige Inzidenzwerte gelb markiert und hohe Inzidenzwerte rot. Wenn man sich die Karte vom 17.03.2021 anschaut, sieht man einige rot markierte Landkreise, sogar den ein oder anderen dunkelroten, aber hauptsächlich gelbe und orange – die Corona-Situation erscheint nicht so dramatisch. Die Skala reicht von „bis 25“ hin zu „bis 500“.
11.04.2021 11:59:48 [VoltaireNet]
Die Wahrheit über das „Sofagate“ von Ankara
Zu Unrecht wurde in der Presse der protokollarische Vorfall in Ankara als Demütigung der Präsidentin der Europäischen Kommission, Ursula von der Leyen, durch Präsident Erdoğan dargestellt. In Wirklichkeit hat er in Absprache mit dem Präsidenten des Rates der Union, Charles Michel, versucht, diesen auf das nichtexistierende Amt des Präsidenten der Union zu heben. Die Nachrichtenagenturen haben Bilder vom Gipfeltreffen EU/Türkei am 6. April 2021 in Ankara weit verbreitet. Hier ist zu sehen, wie der türkische Präsident Recep Tayyip Erdoğan den Präsidenten des Europäischen Rates, Charles Michel, und die Präsidentin der Europäischen Kommission, Ursula von der Leyen, empfängt. Es gibt nur zwei Sessel für drei. Madame von der Leyen, nachdem sie eine Weile gestanden hat, wird sich auf ein Sofa setzen.
11.04.2021 15:10:55 [TAZ]
CDU-Politiker Pfeiffer tritt zurück
Der wegen unternehmerischer Tätigkeiten in die Kritik geratene CDU-Bundestagsabgeordnete Joachim Pfeiffer tritt als wirtschafts- und energiepolitischer Sprecher der Fraktion zurück. Pfeiffer kündigte für den Herbst auch einen Rückzug aus dem Bundestag an und sieht sich als Opfer einer Kampagne und krimineller Aktivitäten.

„Seit drei Wochen muss ich mich gegen eine Kampagne wehren, mit der mir von Teilen der Presse mit konstruierten Behauptungen unterstellt wird, ich hätte mein politisches Mandat mit unternehmerischen Aktivitäten neben dem Mandat in unrechtmäßiger Weise verknüpft“, schreibt der CDU-Politiker in einer auf Samstag datierten Erklärung.

11.04.2021 15:16:28 [RT DE]
Amtsgericht Weimar: Keine Maskenpflicht
Bereits am Donnerstag hat das für Familiensachen zuständige Amtsgericht Weimar in einem Eilverfahren beschlossen (Amtszeichen: 9 F 148/21), dass es zwei Weimarer Schulen mit sofortiger Wirkung untersagt ist, den Schülern vorzuschreiben:

"im Unterricht und auf dem Schulgelände Gesichtsmasken aller Art, insbesondere Mund-Nasen-Bedeckungen, sog. qualifizierte Masken (OP-Maske oder FFP2-Maske) oder andere, zu tragen",
"Mindestabstände untereinander oder zu anderen Personen einzuhalten, die über das vor dem Jahr 2020 Gekannte hinausgehen",
"an Schnelltests zur Feststellung des Virus SARS-CoV-2 teilzunehmen".

 Politik, Verfassung, Grundgesetz, Menschenrechte, Parteien, Wahlen, Demokratie, Recht, Gesetz und Justiz (88)
01.04.2021 07:20:22 [Verfassungsblog]
Dogmatiker als Experten
Warum Rechtswissenschaft und Politik wechselseitig so wenig miteinander anfangen können. Ist das Verhältnis zwischen politischen Organen und Verfassungsrechtswissenschaft von wachsenden Irritationen gekennzeichnet? Die jetzt geführte Debatte hat einen konkreten Anlass, nämlich die Novellierungen des IfSG im Rahmen der Pandemiepolitik. Sie betrifft jedoch ein strukturelles Problem, das Ursachen sowohl in der Eigenrationalität des politischen Willensbildungsprozesses als auch im Rechtssystem hat. Überdies hat sich die deutsche Rechtswissenschaft weitgehend einem Rechtswissenschaftsverständnis verschrieben, das rechtspolitische Expertise einengt.
01.04.2021 07:22:17 [Tichys Einblick]
Die Grünen: Von der direkten Demokratie zur Funktionärs-Herrschaft
Früher war es essentiell für das grüne Menschenbild, dass der mündige Bürger das demokratische Recht haben sollte, selbst politische Entscheidungen zu treffen. Jetzt geht es den Grünen nicht mehr darum, aus der Opposition zu agieren. Jetzt gilt es, die ideologische Vorherrschaft zu sichern. Und da kommen mögliche Bürgermehrheiten, die der grünen Ideologie widersprechen, ungelegen. So haben sich die Grünen auf ihrem letzten Parteitag von der Forderung nach direkter Demokratie verabschiedet. Bundesweite Volksentscheide sollen nicht eingeführt werden.
01.04.2021 15:11:19 [Verfassungsblog]
Das staatliche Pandemiemanagement im Lichte des Verfassungsrechts
Seit Beginn der Pandemie wird darum gestritten, was aus den demokratischen, rechts-, bundes- und sozialstaatlichen Gewährleistungen des Grundgesetzes für das Pandemiemanagement folgt. Da liegt es nicht fern, neben den Krisen von Gesundheits-, Wirtschafts- und anderen gesellschaftlichen Systemen auch eine Verfassungskrise zu diagnostizieren. Wird der Alltags-Lockdown von einer Art verfassungsrechtlichem Lockdown begleitet? Die entsprechenden Diagnosen, Warnungen und Mahnungen begleiten den öffentlichen Diskurs seit einem Jahr– gerade auch von Seiten der Verfassungsrechts- und Politikwissenschaft. Von einer „Verfassungskrise, wie die Bundesrepublik sie noch nicht erlebt hat“, war die Rede.
01.04.2021 15:17:03 [Telepolis]
Grüne im Ländle: Zerrissene Wahlsieger
Die Grünen in Baden-Württemberg vertrauen wohl selbst nicht so sehr auf die Weisheit von Winfried Kretschmann, wie sie mit dem Slogan "Er denkt ans Ganze" auf den Wahlplakaten für ihren Spitzenkandidaten und Landesvater signalisiert hatten. Jedenfalls scheint es im Landesvorstand der Partei mehrere Menschen zu geben, die im Gegensatz zu Kretschmann eine Fortsetzung der "grün-schwarzen" Koalition mit der CDU für keine gute Idee halten - und sich nicht einfach unterbuttern lassen.

Zur Debatte steht auch ein "Ampelbündnis" mit SPD und FDP. Ein entsprechender Vorstandsbeschluss musste daher am Donnerstag vertagt werden.

01.04.2021 17:13:50 [Netzpolitik]
Warum wir jetzt sechs neue Grundrechte für Europa brauchen
Die entscheidende Passage in Ferdinand von Schirachs neuem Buch „Jeder Mensch“ ist nur wenige Sätze lang: Es sind sechs neue Grundrechte. Sie haben die Kraft , unsere Gesellschaft nachhaltig zum Besseren zu wenden, wenn wir es wollen. In meinem Hauptberuf bei der Gesellschaft für Freiheitsrechte führe ich gerade mehrere Verfahren gegen die Verarbeitung von Fluggastdaten durch die Polizei. Die sogenannte PNR-Richtlinie erlaubt es dem Bundeskriminalamt, in den Daten aller Passagiere internationaler Flüge nach „Mustern“ zu suchen. Dadurch sollen „bislang unbekannte Verdächtige“ entdeckt werden, also Menschen, die noch nie auffällig wurden, geschweige denn sich etwas haben zuschulden kommen lassen.
01.04.2021 17:23:04 [Tichys Einblick]
In Hongkong dürfen nur noch Gesinnungstreue gewählt werden
China reagiert auf die Hongkonger Demokratiebewegung mit einer radikalen »Reform« des Wahlrechts zum Stadtparlament. Weniger direkt gewählte und mehr ständische Vertreter bedeuten mehr Einfluss für Xi Jinping. Antreten kann künftig nur noch, wer sich als rotchinesischer »Patriot« bekennt und so die Gnade Pekings findet.

Mit entschiedener Hand hat die chinesische Führung das Wahlsystem der Sonderverwaltungszone Hongkong in ihrem Sinne umgestaltet und die direkt von allen Hongkongern gewählten Abgeordneten im Stadtparlament weiter marginalisiert. Mitte März hatte der Nationale Volkskongress die Änderung des Wahlgesetzes beschlossen, nun hat der ominöse Ständige Ausschuss des Volkskongresses sie einhellig bestätigt.

01.04.2021 17:33:35 [Kontext Wochenzeitung]
Koalitionsverhandlungen: Dieser Weg wird kein leichter sein
Woche drei nach dem historischen Wahldebakel für die CDU startet mit Aufräumungsarbeiten: Ministerpräsident Winfried Kretschmann lädt zur ersten bildungspolitischen Videokonferenz ihrer Art seit Beginn der Pandemie. Endlich kommen alle Beteiligten in direkten Austausch mit dem Entscheider. Die bisherige Entscheiderin, Noch-Kultusministerin Susanne Eisenmann (CDU), hatte genau solche Diskussionen zu Wünschen und Beschwerden der Praktiker tunlichst vermieden. Monika Stein, die Landesvorsitzende der Gewerkschaft Erziehung und Wissenschaft (GEW), fasst die Stimmung zusammen: "Nach dem monatelangen Streit haben wir jetzt den Eindruck, dass die Meinung der pädagogischen Experten wieder gefragt ist."
02.04.2021 07:16:26 [Blog der Republik]
Gesinnungsschnüffelei und Berufsverbote
„Es ist schon fatal“, schreibt Peter Merseburger in seiner ausgezeichneten Biographie über Willy Brandt, „wenn gerade er, der ja den größeren, nicht zu Gewalt neigenden Teil der rebellierenden Jugend in den demokratischen Prozess integrieren will, seine Unterschrift unter jenen Erlass setzt, der Andersdenkende mit beruflicher Repression droht. Wo bleibt da das große Versprechen aus der Regierungserklärung, mehr Demokratie zu wagen?“ Ja, dieser Radikalenerlass, „als Flankenschutz gegen die Volksfrontangriffe der Rechten“ gedacht, so Merseburger, gerät zur Gesinnungsschnüffelei und er kostete den Friedensnobelpreisträger und ersten SPD-Bundeskanzler „Glaubwürdigkeit bei der jungen Generation.“
02.04.2021 12:04:30 [Lost in EUrope]
Wahlumfragen: Mit der CDU stürzt auch die EVP ab
Bisher war die CDU “die” deutsche Europapartei, über die Europäische Volkspartei EVP gab sie auch in Brüssel den Ton an. Doch das scheint sich zu ändern – das Impfdebakel, die CDU-Krise und der Austritt der ungarischen Fidesz aus der EVP führen zu deutlichen Verschiebungen.

Dies zeigt eine Sitzprojektion, die der Blog “Der europäische Föderalist” aus nationalen Wahlumfragen errechnet hat. Demnach stürzt die EVP auf ihr schwächstes Ergebnis seit 1989 ab. Auch der Vorsprung der EVP vor der zweitstärksten Fraktion, der sozialdemokratischen S&D, reduziert sich in der Sitzprojektion deutlich. Ansonsten ergeben sich gegenüber der letzten Projektion wenig Verschiebungen.

02.04.2021 12:17:08 [Verfassungsblog]
Jenseits der Erfahrung
Verfassungsrechtliche Expertise zwischen Ungewissheit und politischem Handlungsdruck. I. Die Corona-Krise als Beispiel: Verfassungsrechtliche Kritik ohne angemessene Realitäts- und Problembeschreibung. Wer immer in öffentlicher Debatte in einer verfassungsrechtlichen Perspektive zu einem politisch relevanten Thema Stellung beziehen will, ist dazu frei. Niemand hat hier in irgendeinem Sinne „Zurückhaltung“ zu verlangen. Kritische Analysen – der Gesetzgebung, eines anderen staatlichen Handelns usw. – sind naturgemäß von besonderem Interesse.
02.04.2021 16:47:09 [Tichys Einblick]
Die Parteien bedienen sich selbst
Das Thema ist heikel, weil man als Kritiker sofort unter Generalverdacht steht, nur billiges Parteien-Bashing betreiben zu wollen. Doch das liegt mir fern. Dass die Entscheidungsstrukturen einer parlamentarischen Demokratie Kosten verursachen, ist klar. Man braucht qualifiziertes Personal, nicht nur im Parlament, sondern auch im Mitarbeiterstab der Abgeordneten. Auch die nötigen Infrastrukturkosten – von der Technik bis zu den Räumlichkeiten – haben ihren Preis. Schließlich wird den Parteien im Grundgesetz ein eigener Artikel eingeräumt: „Die Parteien wirken bei der politischen Willensbildung des Volkes mit. Ihre Gründung ist frei. Ihre innere Ordnung muss demokratischen Grundsätzen entsprechen.“
03.04.2021 06:46:23 [Berliner Zeitung]
Anwältin: „Es ist unglaublich, was wir da erleben“
Die Anwältin Jessica Hamed erzählt, aus welchen Gründen ihre Mandanten in der Corona-Pandemie vor Gericht kämpfen müssen. Frau Hamed, für privilegierte und gut situierte Leute sind die Einschränkungen durch die Corona-Maßnahmen zwar lästig, aber im Grunde verkraftbar. Doch es gibt große Gruppen, für die der Verlust der Grundrechte existentielle Folgen hat. Sie vertreten als Anwältin auch die sozial Schwachen. Von welchen Gruppen sprechen wir hier?

Ich vertrete zum Beispiel Kinder und Jugendliche, Behinderte und chronisch Kranke, alte Menschen, Geflüchtete und Menschen in sozial prekären Situationen. Dazu gehören auch Anfragen von Bezieherinnen von Arbeitslosengeld II.

03.04.2021 09:21:35 [Verfassungsblog]
Allgemeines „Kopftuchverbot“ durch die Hintertür?
Zum Regierungsentwurf eines Gesetzes zur Regelung des Erscheinungsbilds von Beamten („lex Tattoo“). Die Gesellschaft wird vielfältiger und mit ihr (obgleich verzögert) auch der öffentliche Dienst. Je „bunter“ er wird, desto häufiger muss er Konflikte um die äußere Erscheinungsform der Beamten lösen. Die Rechtsprechung hat hierbei in jüngster Zeit mit Recht den Vorbehalt des Gesetzes gestärkt und den Durchgriff der Dienstbehörden auf oftmals persönlichkeitsnahe Ausdrucksformen von Individualität rechtsstaatlich eingehegt. Das gilt nicht zuletzt auch für Tattoos: Schon 2017 hatte das BVerwG festgestellt, dass es einer hinreichend bestimmten gesetzlichen Ermächtigung bedarf, das zulässige Ausmaß von Tätowierungen bei Beamten zu regeln.
03.04.2021 11:20:04 [Junge Welt]
Nach der Wahl: Grüne retten CDU
Bewahrung der Welt – einige »humanitäre Kriege« eingeschlossen – war gestern, heute kümmern sich die Grünen um die CDU. Der geht es in Umfragen schlecht, besonders schlimm steht es in Baden-Württemberg. Dort erhielten die Grünen bei den Landtagswahlen am 14. März 32,6 Prozent der Stimmen – historischer Spitzenwert, die CDU kam auf 24,1 Prozent – historischer Tiefstand. 17 Tage lang antwortete Ministerpräsident Winfried Kretschmann (Grüne) öffentlich nicht auf die Koalitionsfrage und führte eine fünfköpfige Gruppe in Sondierungsgespräche mit SPD und FDP einerseits, mit der CDU andererseits.
03.04.2021 13:16:49 [WSWS]
Baden-Württemberg: Grüne erneuern Koalition mit CDU
Am Donnerstag beschloss der Landesvorstand der Grünen in Baden-Württemberg, die Koalition mit der CDU fortzusetzen.

Die Grünen, die in dem südwestlichen Land mit Winfried Kretschmann seit zehn Jahren den Ministerpräsidenten stellen, waren als stärkste Partei aus der Landtagswahl vom 14. März hervorgegangen, während die CDU fast 300.000 Stimmen verlor und in ihrem einstigen Stammland das historisch schlechteste Ergebnis einfuhr. Die Wahlniederlage war das Ergebnis für die rechte Politik der grün-schwarzen Koalition, die eine Politik der Sozialkürzungen, der Staatsaufrüstung und der Durchseuchung verfolgt hatte.

03.04.2021 15:29:11 [IPG - Internationale Politik und Gesellschaft]
Nicht weit vom Stamm
Angela Merkels Kanzlerschaft erinnert stark an die Ära Kohl. In der Coronakrise führte ihr Regierungsstil zum Versagen der deutschen Politik. Nun hat es Angela Merkel doch nicht geschafft, rechtzeitig zu gehen. Nicht nur die Dauer der Regierungszeit, auch deren Ende gleicht zunehmend dem der Ära Kohl: ein bleiernes fin de regne in einem erstarrten Land. Ironischerweise enthüllt sich in dieser Parallelität ein Umstand, den viele Bewunderer Merkels nie richtig wahrhaben wollten: wie sehr die Machtpraxis Merkels der Helmut Kohls ähnelte. Dessen Art Politik zu machen, war unterlegt von drei eisernen Regeln: Probleme kann man aussitzen. Funktioniert das nicht, wirft man sie mit „Bimbes“ (sprich: Steuergeldern) zu. Und Fehler werden niemals zugegeben.
03.04.2021 17:16:00 [Verfassungsblog]
Kritik ist kein Selbstzweck
"Wir werden in ein paar Monaten einander wahrscheinlich viel verzeihen müssen." Diesen hier sinngemäß zitierten Satz hat Jens Spahn bei einer Regierungsbefragung zu den ersten Maßnahmen zur Eindämmung der Covid 19-Pandemie im Frühjahr 2020 gesagt. Ich denke, dass sich auch die Staatsrechtslehre davon angesprochen fühlen sollte. Was ich in der Zeit, als wir in den Ministerien buchstäblich Tag und Nacht durchgearbeitet haben, um in kürzester Zeit ein tragfähiges rechtliches Instrumentarium für den Umgang mit dieser nie da gewesenen Situation zu schaffen, lesen musste, war teils schon sehr heftig.
03.04.2021 18:46:31 [RT DE]
Konfrontation und Krieg oder Koexistenz – das bleibt die Frage!
Angesichts der "Gefährdung" ihrer imperialistischen Ziele durch Russland und China überlegen sich die Westmächte Strategien, dem entgegenzuwirken. Die Alternative zur Aufhebung des Völkerrechts ist eine neue Weltordnung, die auf friedlicher Koexistenz beruht. Nach seiner Wahl hat der neue Präsident der USA davon gesprochen, dass "Amerika zurück" sei, dass "Diplomatie", also das Mittel zur Durchsetzung von Politik, zurück ist – aber nur wenige fragen nach dem Inhalt der Politik, die er mit Diplomatie durchsetzen will. Gleichzeitig bezichtigt er den Präsidenten Russlands, ein "seelenloser Killer" zu sein, und verleumdet damit das ganze russische Volk.
03.04.2021 18:49:37 [Zeit Online]
Frontex: Bundesregierung will Push-backs nicht selbst aufklären
Drängen auch deutsche Polizisten an der griechischen Grenze Migranten zurück? Die Bundesregierung ist zwar ihr Dienstherr, will die Aufklärung aber Frontex überlassen. Seit Monaten gibt es Berichte, dass die griechische Küstenwache an der Grenze Migranten zurück in türkische Gewässer drängt, obwohl die Genfer Flüchtlingskonvention und das Europarecht das verbieten. Zuletzt erklärte eine Vertreterin des Flüchtlingshilfswerks der Vereinten Nationen UNHCR, seit Beginn des Jahres 2020 habe man "mehrere Hundert Fälle" solcher sogenannter Push-backs registriert. Die Europäische Grenzschutzagentur Frontex, die an den Inseln ebenfalls im Einsatz ist, soll von solchen Vorfällen teilweise gewusst oder daran beteiligt gewesen sein.
03.04.2021 18:52:15 [Verfassungsblog]
Ganz so einfach ist es nicht
Zur Frage, ob die Bundesregierung die Pandemiemaßnahmen auch selbst erlassen kann. Im politischen Berlin steigt die Unzufriedenheit über die Pandemiebekämpfung der Länder. Die Koordination zwischen Bund und Ländern im Rahmen der Bund-Länder-Konsultationen ist nicht transparent und wird als zunehmend dysfunktional wahrgenommen (Stichwort verlängerte Osterruhe). Zudem reagieren die Länder bislang eher zurückhaltend auf die Dritte Welle der Pandemie.

Eine einfache Lösung scheint nun auf der Hand zu liegen: Pandemiebekämpfung durch den Bund, Erlass von Rechtsverordnungen durch die Bundesregierung.

04.04.2021 07:02:43 [Novo Argumente]
Waffennarr oder Bürgerrechtsaktivist?
Die Besitzer legaler Waffen werden immer mehr bevormundet, auf EU- und nationaler Ebene. Ihren Interessenvertretern will man absprechen, sich für Freiheitsrechte zu engagieren.

Im März 2020 berichtete der Spiegel über die deutsche Schützenlobby, die sich der nationalen Umsetzung der EU-Feuerwaffenrichtlinie widersetzte. Das Online-Titelbild zeigt mich mit der Unterschrift „Waffenlobbyistin Triebel: ‚Flut an Protestmails‘“ und diffamierte mich im Text als „selbst ernannte ‚Bürgerrechtsaktivistin‘“. Da stellt sich doch die Frage, warum ich als Mitinhaberin eines Berliner Familienbetriebs in vierter Generation für Jagd- und Sportwaffen als Waffenlobbyistin dargestellt werde und mein Engagement zur Einhaltung von bürgerlichen Rechten gemäß Grundgesetz in Anführungszeichen gesetzt wird.

04.04.2021 07:18:37 [Telepolis]
Corona-Maßnahmen: Wie weit geht die Polizei?
Das Video zum Polizeieinsatz in Brüssel zeigt eindeutige Bilder: Ein berittener Polizeitrupp wirft eine Frau zu Boden. Sie stand zuvor, mit großem Abstand zu anderen allein auf einer Wiese, machte keine provakanten Gesten, sondern schaute, beschäftigt mit ihrer Hose, in die falsche Richtung.

Nachdem sie das Pferd, gelenkt von einem Polizisten, umgerammt hatte, blieb sie regungslos liegen. Die Polizisten auf den Pferden ritten ungerührt weiter. Geht es nach den Videobildern machte der Trupp keine Anstalten, unmittelbar nach diesem Geschehen umzukehren. Ob das dann mit einigen Minuten Verspätung geschah, gibt der Clip nicht zu erkennen.

04.04.2021 09:33:16 [Verfassungsblog]
Herbeireden einer Verfassungskrise
Dass der Verfassungsblog ein Symposion über die Rolle der Verfassungsrechtswissenschaft in der Pandemie angestoßen hat, wird man nur begrüßen können; die Debatte, obwohl auch andernorts schon geführt, ist in ihrer Bedeutung für das Selbstverständnis des Faches gar nicht hoch genug einzuschätzen. Anna-Bettina Kaiser und Matthias Jestaedt haben dazu nun unter der Überschrift „Kritik ja, Verfassungskrise nein“ einen Artikel veröffentlicht, in dem sie sich, wie einige andere vor ihnen auch schon, kritisch mit der gerade von Verfassungsrechtlern an verschiedenen Elementen der Pandemiebekämpfung geäußerten Kritik auseinandersetzen: Wegen der Gefahr populistischer Vereinnahmung müsse sich gerade die Verfassungsrechtswissenschaft, so die Grundaussage, in der derzeitigen Situation ihrer Verantwortung bewusst sein und auch in ihren Formulierungen jede Zuspitzung vermeiden.
04.04.2021 11:32:02 [ISW - sozial ökologische Wirtschaftsforschung]
Russlands Modernisierung im Wechsel von Berg- und Talfahrten
Die Entwicklung der Russischen Föderation (RF) kann den Deutschen nicht gleichgültig bleiben. Für einen dauerhaften Frieden in Europa müssen sie ein strategisches Interesse an guten Beziehungen zu Russland haben. Dafür ist u. a. die innere Verfasstheit der Russischen Föderation von großer Bedeutung. Die wirtschaftliche und soziale Entwicklung beeinflusst maßgeblich die innere Stabilität und letztlich auch die Außen- und Sicherheitspolitik Russlands. Durch die nach dem „Putsch“ von Präsident Jelzin gegen die Duma im Oktober 1993 in einem Referendum im Dezember 1993 verabschiedete Verfassung wird die Russische Föderation als föderaler Staat definiert, der gegenwärtig aus acht Föderationskreisen und 85 Föderationssubjekten besteht, und sich als sozialer Rechtsstaat versteht.
04.04.2021 13:18:22 [Der Freitag]
„Ohne Recht gibt es kein Eigentum“
Interview: Katharina Pistor weiß, wie Anwälte die Reichen reicher machen. Sie unterrichtet Jura-Studierende. Der Freitag: Frau Pistor, die meisten Leute denken, Kapital ist eine Summe Geld. Ökonomen sagen, Kapital ist ein Produktionsfaktor: Fabrik, Maschine, Boden. Sie sagen, beides ist falsch. Warum?

Katharina Pistor: Das ist ein verkürztes Verständnis von Kapital. An sich ist Land ein Stück Dreck. Es hat im Grunde keine ökonomische Funktion im kapitalistischen Sinne, außer wenn ich ein soziales Konstrukt drüber mache, das dazu dient, Land monetarisieren zu können.

04.04.2021 15:17:13 [Verfassungsblog]
Der deutsche Exekutivföderalismus in der Pandemie
Die bundesstaatliche Ordnung des Grundgesetzes scheint den Herausforderungen der COVID-19-Pandemie nicht gewachsen. Wenn der bayerische Ministerpräsident für mehr Bundeskompetenzen plädiert und am gleichen Tag die Bundeskanzlerin die Länder an ihre Pflicht zur Umsetzung beschlossener Maßnahmen erinnert, nachdem beide kurz zuvor bis in die frühen Morgenstunden mit den anderen Spitzen der Landesregierungen um Konsens gerungen haben, dann zeigt sich das föderale System nicht in Bestform. Jedenfalls scheint es weit entfernt von einer klaren Zuweisung von Zuständigkeiten und Abgrenzung der Verantwortlichkeiten, auf die es zur Bewältigung einer „epidemischen Lage von nationaler Tragweite“ (§ 5 Infektionsschutzgesetz, IfSG) ankommt.
04.04.2021 17:08:22 [Tichys Einblick]
Die AfD ringt um die Spitzenkandidaten
Während alle Augen auf das Drama des Abstiegskampfs der CDU gerichtet sind, sortiert sich derweil die AfD für den Bundestagswahlkampf. Dort werden offenbar die Karten derzeit neu gemischt. Überraschend haben sich mehrere Mitglieder des AfD-Bundesvorstands für die hessische Bundestagsabgeordnete Joana Cotar als Spitzenkandidatin neben Tino Chrupalla, den Co-Parteichef aus Sachen, ausgesprochen. Manchen erscheint das als gute Lösung: Mann und Frau, Ost und West, der rechts-soziale Flügel und das bürgerlich-freiheitliche Lager würden zusammengeführt. So hat es das Bundesvorstandsmitglied Alexander Wolf aus Hamburg angeregt.
04.04.2021 17:12:37 [Infosperber]
Den Bundeskanzlern dämmert es meist zu spät
Es ist ein legendärer Satz: «Die kann das nicht». Gesagt hat ihn der deutsche Bundeskanzler Gerhard Schröder (SPD) am Wahlabend des 18. September 2005. Gemeint war Angela Merkel, die bei den vorgezogenen Bundestagswahlen mit ihrer CDU/CSU knapp vor der SPD lag. Schröder gelang es am Wahlabend rhetorisch, die Wahlniederlage in einen gefühlten Wahlsieg zu verwandeln – weil «niemand ausser mir in der Lage ist, eine stabile Regierung zu stellen. Niemand ausser mir!» Noch tagelang verkündete die SPD-Spitze: «Gerhard Schröder bleibt Kanzler!» Auch die mächtigen CDU-Landesfürsten trauten ihrer Spitzenkandidatin zu Beginn wenig zu, interpretierten ihren Wahlsieg lange als eine Art Betriebsunfall.
04.04.2021 18:45:11 [Der Freitag]
Niederlagen sehen anders aus
Die Abgesänge waren verfrüht: Der Rechtspopulismus ist in Österreich und den USA weiter stark. Zweifellos, die Pandemie hat auch den rechten Populismus auf dem falschen Fuß erwischt. Der erste Reflex führt meist dazu, sich hinter die Regierenden zu stellen. Doch wenn die Krise anhält und permanent wird, wie gestaltet sich die zweite oder dritte Reaktion? Noch dazu, wenn vieles, was heute unwidersprochen bleibt und politisch unumgänglich erscheint, sich rückblickend als Irreführung und Irrtum, Selbsttäuschung und Täuschung herausstellen sollte. Genau das wird der Fall sein. Die Pandemie wird Stimmungen und Stimmen noch mehr rotieren lassen, als dies schon bisher der Fall gewesen ist.
04.04.2021 18:59:47 [Telepolis]
Abschied von Mutti
Schwindet mit Angela Merkel auch ihr Politikstil der Risikoscheu und Veränderungsfeindschaft? Es herrscht Chaos und die Bundeskanzlerin hat die Lage nicht mehr im Griff. Politik ist aber immer auch das, was möglich ist. Wenn man Angela Merkel zuletzt zugehört hat, etwa bei ihrem öffentlichen Bitten "um Verzeihung", dem bezeichnenderweise keine neuen Ideen, kein "Plan B" folgte, oder bei ihrem Auftritt bei "Anne Will", der auch nur aus Rechtfertigungen des eigenen Handelns bestand, dann bekommt man den Eindruck, dass das schwache Bild des Staates und der derzeitigen Regierenden auch etwas mit dem von der Kanzlerin implementierten Politikverständnis zu tun hat.
04.04.2021 19:05:08 [Blätter]
Land ohne Alternative: Die Republik nach Merkel
Gut ein Jahr nach Beginn der Coronabekämpfung in Deutschland und ein halbes Jahr vor der Bundestagswahl hat sich die Lage im Lande fundamental verändert. Aufgrund eines missratenen Impfstarts, steigender Infektionszahlen in der dritten Welle der Pandemie und einem Lockdown bis Mitte April ist aus dem anfänglichen Regierungsbonus ein Malus geworden – und aus einer vormals unangefochtenen CDU eine Partei im Sinkflug nach zwei vernichtenden Niederlagen in den einstigen Stammlanden Baden-Württemberg und Rheinland-Pfalz.
05.04.2021 15:55:13 [Telepolis]
Nicht ohne ihre Mütter
In zwei von Kurden kontrollierten Lagern in Nordostsyrien, wo Mitglieder und Angehörige der Terrororganisation "Islamischer Staat" interniert sind, halten sich nach Medienberichten 19 Minderjährige mit dänischer Staatsbürgerschaft auf. "Diese Kinder sind in einer schwierigen Situation", erklärte die dänische Regierungschefin Dänemarks, Mette Frederiksen. Man wolle ihnen helfen.

Ihr Schicksal sowie das ihrer sieben Mütter beschäftigt das Parlament seit Tagen. Das Thema bringt auch die sozialdemokratische Minderheitsregierung in "eine schwierige Situation", wie es in Kopenhagen heißt. Sollen die Kinder im Lager verbleiben oder nach Dänemark zurückgeholt werden?

05.04.2021 16:57:27 [Preußische Allgemeine Zeitung]
Glanzlos, mutlos, orientierungslos
Die Landtagswahlen im Südwesten offenbarten gleich mehrere Probleme der CDU. Eines der größten ist die inhaltliche Entkernung im Laufe des letzten Jahrzehnts. Die Zukunft der Partei am Ende der Ära Merkel ist ungewiss. Wie gut, dass der „Maskenskandal" vor den jüngsten Landtagswahlen öffentlich wurde! Denn nun ist klar, dass bloß Einzelne das Vertrauen in die CDU geschädigt haben. Von ihnen trennt man sich, und dann geht es mit Zuversicht in die kommenden Wahlkämpfe. Hat nicht die CDU in der Corona-Krise durch ihre beherzte Politik Zehntausende von Leben gerettet? Na also! Nein. Denn als einzig Tröstliches kann von CDU-Freunden vermerkt werden, dass nach dem Wahldebakel kein Unionspolitiker öffentlich so argumentiert hat.
05.04.2021 16:59:31 [Tichys Einblick]
Demokratiefördergesetz: Die SPD hielt noch nie etwas von der Extremismusklausel
Kristina Schröder als Familienministerin hatte 2011 eine Extremismusklausel in ihr Fördergesetz geschrieben. Die SPD wollte bald nichts mehr davon wissen – und bleibt bis heute stur bei dieser Haltung. Zusammen mit Linken und Grünen wollen uns die Genossen in eine unsichere Bevormundungsgesellschaft führen. Am 21. Dezember 2013 posaunte es der Spiegel in die Welt hinaus: Familienministerin Manuela Schwesig distanzierte sich – auf wessen Rat auch immer – von der Extremismusklausel, die ihre CDU-Vorgängerin Kristina Schröder für die hauseigenen Förderanträge in Sachen »Demokratieförderung« eingeführt hatte.
05.04.2021 17:21:51 [Novo Argumente]
Keine Ruhepause im Corona-Regime
Der Zirkel aus Kanzlerin und Ministerpräsidenten umgeht das Grundgesetz und treibt weiter autoritäre Politik voran. Die Frage des Gründonnerstags spielt dabei keine entscheidende Rolle.

Markus Söder hat „persönlichen Respekt“, Armin Laschet gar „großen Respekt“ vor der Mitteilung der Bundeskanzlerin, den Sonder-Shutdown am Gründonnerstag wieder abzublasen. Immerhin gibt der NRW-Ministerpräsident zu: „Wir haben diesen Weg mitgetragen und nicht widersprochen.“ Das gilt allerdings für die gesamte deutsche Corona-Politik – und ebenso für die vorangegangenen einschneidenden Merkel-Weichenstellungen bei der Euro-„Rettung“, der Energiewende, der Flüchtlingspolitik usw.

05.04.2021 18:44:58 [Deutschlandfunk Kultur]
Nawalny und Assange: Die Doppelmoral muss ein Ende haben
Politik wie auch Medien verfahren sehr unterschiedlich mit zwei Dissidenten, die beide staatlicher Verfolgung ausgesetzt sind: Alexej Nawalny und Julian Assange. Seit dem Mordanschlag auf Nawalny im August vorigen Jahres ist der Name des „Kremlkritikers“ nicht allein in Deutschland fast zu einem Markenzeichen geworden.

Er steht sinnbildlich für die von Elitenvertretern forcierte Wahrnehmung Russlands als ein „Schurkenstaat“, mit dem die Beziehungen – wo immer möglich – zurückzufahren seien. Dementsprechend diente der Fall Nawalny monatelang als Argument, um den Bau der ungeliebten Erdgas-Pipeline Nord Stream 2 doch noch zu verhindern – ohne Erfolg.

05.04.2021 18:51:35 [RT DE]
Bidens Äußerungen über Putin sind ein Rückfall in vulgären Rassismus
Ich bin weit davon entfernt, irgendeine Bewunderung für Donald Trump zu hegen, aber Joe Bidens Worte über den "Killer Putin" und seinen angeblichen "Mangel an Seele" ließen mich fast nostalgisch bezüglich einiger Aspekte der Trump-Jahre werden. Als Biden gefragt wurde, ob er glaubt, dass Putin ein Killer sei, antwortete er: "Das tue ich." Er sprach auch davon, wie er 2011, als er noch US-Vizepräsident war, Putin persönlich gesagt haben will, dass dieser "keine Seele hat." Biden: "Ich war kein Klugscheißer, ich war allein mit ihm in seinem Büro." (Was soll das bedeuten? Soll das heißen, dass es mutig ist, mit dem "seelenlosen Mörder" Putin allein zu sein?)
06.04.2021 09:35:11 [RT DE]
Plädoyer gegen Pandemie-Notstands-Ermächtigungsvertrag
Bei ihrem jüngsten Vorstoß für einen "Pandemie-Vertrag" im Stil der Zeit nach dem Zweiten Weltkrieg missbrauchen die Weltpolitiker die COVID-19-Pandemie für eine große Machtübernahme. Darum gilt es, diesen Vorstoß abzuwehren. Wer zwischen den Zeilen liest, kann ganz klar erkennen: Bei diesem Plan geht es zwar angeblich um mögliche Pandemien nach der COVID-19-Krise – doch in Wirklichkeit will man damit sicherstellen, dass die drakonischen Maßnahmen, die seit dem Jahr 2020 verhängt werden, so lange wie möglich beibehalten bleiben.
06.04.2021 12:56:12 [Zeit Online]
Ausgangssperren: Nicht von der Verfassung gedeckt
Um die Pandemie zu kontrollieren, setzen einige Bundesländer auf nächtliche Ausgangssperren. Doch die Maßnahme ist zu drastisch und zugleich wenig wirksam. Ausgangssperren sind ein probates Mittel der Politik – in Diktaturen und autoritären Regimen. Sie dienen dazu, das Verhalten der Bevölkerung zu kontrollieren. Letztlich zerstören sie das öffentliche Leben und behindern Kontakte und Kommunikation unter den Bürgern. Deshalb sind sie gut geeignet, um autoritäre Staatsmacht zu sichern. In Demokratien sind sie eher verpönt. Vor diesem Hintergrund ist es mehr als irritierend, dass in Deutschland und in anderen europäischen Staaten Ausgangssperren verhängt werden.
06.04.2021 13:17:21 [M 7]
Woher der Mangel an Strategie?
Der Mangel an politischen Strategien, die miteinander in Konkurrenz stehen und für die es sich trefflich zu streiten lohnt, wird von allen Seiten beklagt. Nicht nur innerhalb der Wählerschaft, unabhängig zu den parteilichen Präferenzen, sondern auch aus dem Lager der Berufspolitiker. Die naheliegende Frage wäre die, warum sie keine attraktiven Strategien anbieten, wenn auch sie den Zustand der Dominanz des Tagesgeschäftes beklagen? Eine These, die aufrichtig gemeint ist und jenseits der Polemik liegt, lautet ganz schlicht: weil sie es nicht können. Woran das liegt? Die Behauptung: Am Milieu, in denen sie sozialisiert wurden.

Vor Jahren bereits hatte sich ein amerikanischer Soziologe mit der gleichen Frage in Bezug auf die USA beschäftigt.

06.04.2021 14:49:25 [Der Freitag]
Ein Mann für alle Fälle
Porträt: Karl Lauterbach ist der beste Gesundheitsminister, den Deutschland nie hatte. Zum Helden aber taugt er nicht. Schon länger lag die Frage in der Luft. Ausgesprochen wurde sie dann – im Scheinwerferlicht der Kameras – am 19. März auf der Bundespressekonferenz. „Wäre Karl Lauterbach nicht der bessere Gesundheitsminister?“, forderte ein Kollege Jens Spahn, dem der SPD-Mann an diesem Tag assistierte, heraus. Beide versichern, sich „ewig zu kennen“ und immer „gut zusammengearbeitet“ zu haben. Aber wer weiß, setzt Spahn dann doch etwas gewurmt hinzu, „vielleicht wird er ja noch mal Gesundheitsminister.“ Nach der nächsten Bundestagswahl.
06.04.2021 16:51:55 [Verfassungsblog]
Die Asyl- und Abschiebepolitik zu Afghanistan zu Zeiten von Covid-19
An diesem Mittwoch, den 7. April wird vom Flughafen in Berlin-Schönfeld eine weitere Sammelabschiebung nach Afghanistan stattfinden. Diese Sammelabschiebungen sind zur Normalität geworden und in der Berichterstattung kaum mehr der Rede wert. Ebenso wenig die regelmäßigen Anschläge in dem Land, das sich in einer katastrophalen humanitären Situation befindet. Nach den Erhebungen des Global Peace Index ist Afghanistan derzeit das gefährlichste Land der Welt. In keinem anderen Staat weltweit sterben mehr Menschen aufgrund von bewaffneten Auseinandersetzungen. Zugleich ist das Land auch als Folge der jahrzehntelangen Gewalt eines der ärmsten Länder der Welt.
06.04.2021 17:06:54 [NachDenkSeiten]
Die Abschiebeoase
Auch in Zeiten von Krieg und Pandemie werden Geflüchtete weiterhin nach Afghanistan abgeschoben. Allein in den letzten Wochen fanden mehrere Abschiebungsflüge statt. Die Betroffenen stehen oftmals vor dem Nichts – und landen in einem fragwürdigen Hotel in der Kabuler Innenstadt. Das Hotel „Spinzar“ liegt im Herzen Kabuls. Nahe der belebten Hauptstraße befindet sich der alte Basar, die Baghe-Omumi-Brücke sowie die bekannte „Moschee des Zweischwertigen Königs“. Viele Menschen spazieren am Hotel vorbei, ohne dem Gebäude Beachtung zu schenken. Es wirkt unauffällig und etwas heruntergekommen, so wie viele andere Bauten in der Gegend.
06.04.2021 18:47:34 [Telepolis]
"Grün-Schwarz" im Ländle
Mutig wirkt im Sondierungsergebnis von Grünen und CDU in Baden-Württemberg vor allem das Versprechen, das aktive Wahlrecht bereits ab 16 Jahren zu gewähren - denn führenden Mitgliedern der Grünen Jugend gefiel die Vorstandsentscheidung der Mutterpartei für eine Fortsetzung dieser Koalition gar nicht. Von einem "Schlag ins Gesicht" sprach die Bundesvorsitzende der Parteinachwuchsorganisation, Anna Peters, vergangene Woche. Es stand sogar der Vorwurf im Raum, dass viele Wahlkampfaktivitäten gar nicht stattgefunden hätten, wenn engagierten Basis-Grünen klar gewesen wäre, dass wieder "Grün-Schwarz" dabei herauskommt.
06.04.2021 18:49:50 [Der Freitag]
Umverteilung: Wohin geben? Und woher nehmen?
Die Grünen fordern einen investierenden Staat. Aber bei der Frage, woher das Geld kommen soll, kneifen sie. „Je besser wir vorsorgen, ... je besser wir schützen, umso freier können wir leben“, so schreiben die Grünen in ihrem Programmentwurf zur Bundestagswahl 2021. Wie passend, inmitten dieser Doppelkrise aus Klimakatastrophe und Pandemie. Und wie nichtssagend zugleich. Die Erfolge der Grünen haben mehrere Gründe, vor allem aber zwei. Erstens: Früher als alle anderen Parteien besetzten sie ein Jahrhundertthema – den Kampf gegen die Gefährdung der Biosphäre.
07.04.2021 11:08:24 [Tichys Einblick]
CSU-Chef Söder entzieht seiner eigenen Partei die Existenzberechtigung
Ausgerechnet ein Regierungschef von Bayern, dem traditionellen Widerstandsnest gegen deutsche Zentralstaatlichkeit, macht nun den Föderalismus schlecht. Dazu passt, dass Söder der scheidenden Bundeskanzlerin eine Art Recht zur Bestimmung ihres Nachfolgers einräumen will. Wie sehr sich Deutschland und seine politische Klasse von der alten Bundesrepublik entfernt haben, macht derzeit vor allem die Führung der CSU deutlich. Wer noch Franz Josef Strauß kannte, muss es für nahezu unfassbar halten, dass nun ausgerechnet ein CSU-Ministerpräsident des Freistaats Bayern in der Bild am Sonntag der Stärkung der Bundesregierung gegenüber den Ländern das Wort redet.
07.04.2021 14:44:13 [TAZ]
Baden-Württemberg: Grüner wird's doch
Die Kretschmann-Partei wird wieder mit der CDU regieren. Eine gute Wahl: Für den Machterhalt schlucken die Schwarzen praktisch alle grünen Wünsche. Spätestens seit der Reaktion des FDP-Fraktionschefs Hans-Ulrich Rülke vom vergangenen Donnerstag auf Kretschmanns Entscheidung, mit der CDU in Koalitionsverhandlungen zu gehen, muss auch dem letzten Ampelfan klar sein, dass die Grünen zumindest für Baden-Württemberg mit der am Boden liegenden Union die bessere, weil berechenbarere Wahl getroffen haben: Die Liberalen seien im Gegensatz zur CDU eben nicht bereit, sich „völlig dem Regulierungs- und Verbotsvorstellungen der Grünen zu unterwerfen“, blafft der Verschmähte den Kretschmann-Grünen hinterher.
07.04.2021 14:54:07 [Kontext Wochenzeitung]
Neue alte Koalition im Landtag: Zurück in die Zukunft
Zehn Jahre Kontext, zehn Jahre Winfried Kretschmann. Und ausgerechnet zum Doppeljubiläum koaliert der Grüne zum zweiten Mal mit den Schwarzen. Wenn der Drahtseilakt schiefgeht, steht viel mehr auf dem Spiel als künftige Wahlerfolge. "Mitunter frisst die Revolution ihre Kinder. Auch wenn sie nur ein Revolutiönchen ist." Nein, es geht nicht darum, dass Winfried Kretschmann, trotz vorhandener Ampel-Alternative, die zweite Koalition mit der CDU riskiert. Vielmehr endet mit diesem Satz die Analyse der neuen Lage wenige Tage nach der Landtagswahl von 2011 – in der allerersten Ausgabe der Kontext-Wochenzeitung. Zehn Jahre später ist es wieder wenige Tage nach der Landtagswahl. Und die Südwest-Grünen stehen vor der größten Herausforderung ihrer Geschichte.
07.04.2021 16:21:04 [Verfassungsblog]
Geht’s raus und spielt’s Fußball!
Das Reden über die Pandemie und deren politische Bewältigung ist schwierig geworden. In Familien und Freundeskreisen wird entweder gar nicht mehr oder nur noch vorsichtig über das Virus gesprochen, weil man sich nicht zerstreiten möchte oder das längst schon getan hat. Auch in der Wissenschaft scheint man sich deshalb teilweise aus dem Weg zu gehen, und die digitale Begegnungskultur leistet das Ihre dazu. Christian Drosten und Hendrik Streeck haben nach eigenen Aussagen seit einem Jahr nicht mehr miteinander gesprochen, obwohl das für die Bewältigung der Pandemie vielleicht ganz hilfreich sein könnte. Das Virus betrifft uns auch als Rechtswissenschaftler persönlich.
07.04.2021 17:04:11 [Antikrieg]
Die politische Krise in Deutschland und die Zukunft von Nord Stream 2
Der Einzug der Biden-Administration in das Weiße Haus war von der Hoffnung begleitet, dass sich die Beziehungen zur Europäischen Union wieder einigermaßen normalisieren würden. Obwohl Biden im Gegensatz zu Obama keinen Friedensnobelpreis allein für seine Existenz erhalten würde, wurde sein Sieg in den europäischen Hauptstädten als Zeichen dafür begrüßt, dass der Liberalismus den Populismus besiegen und eine neue Ära des "business as usual" in der Form einläuten würde, wie es unter der Obama-Administration praktiziert wurde.


07.04.2021 17:12:19 [Tichys Einblick]
Nach Baden-Württemberg-Wahl: Die CDU unterwirft sich den Grünen
Auf dem Weg zum Klimaschutzland unterwirft sich die CDU in ihrem einstigen Kernland bedingungslos dem Programm der Grünen von Winfried Kretschmann. Mehr Windräder, mehr Busse und Bahnen und auf jedem Dach eine Solaranlage – damit will der alte und neue Ministerpräsident Baden-Württembergs, Winfried Kretschmann, ein ambitioniertes Klimaschutzprogramm umsetzen, dass es so in anderen Bundesländern nicht gebe.

Während die Stuttgarter in der Kälte des erneuten Wintereinbruchs bibbern und die Heizungen wieder aufdrehen, versuchten Grüne und CDU bei den Sondierungsgesprächen der von den Grünen posaunten Klimakatastrophe entgegenzuwirken.

07.04.2021 18:57:24 [Tichys Einblick]
Merkel will Maaßen für den Bundestag verhindern
Der Schock über die Schreckensnachricht aus Thüringen währte im Berliner Konrad-Adenauer-Haus, dem Hauptquartier der CDU, nur kurz. Vier Kreisverbände der Union in Süd-Thüringen hatten sich erdreistet, den sich im einstweiligen Ruhestand befindlichen Ex-Chef des Bundesamtes für Verfassungsschutz, Hans Georg Maaßen, aufzufordern, ihr Kandidat für die Bundestagswahlen im September diesen Jahres zu werden. Aus Sicht der Kanzlerin konnte dies nur als Majestätsbeleidigung aufgefasst werden. Hatte sie doch den Rausschmiss Maaßens selbst herbeigeführt.
08.04.2021 07:00:26 [KenFM]
Der Corona-Verfassungsbruch
Seit März 2020 leben wir weltweit in einem pandemischen Ausnahmezustand. Das neuartige Corona-Virus SARS-CoV-2 hat sich auch in Deutschland ausgebreitet. Das Robert-Koch-Institut (RKI) verzeichnete bis zum 21. Januar 2021 in Zusammenhang mit dem Virus 49.783 Todesfälle. Das RKI ermittelt nicht, ob die Personen an oder mit Corona gestorben sind. Bei den Verstorbenen handelt es sich überwiegend um Personen im Alter von über 70 Jahren mit Vorerkrankungen. Die Sterberate in Deutschland 2020 liegt nach den Sterbezahlen des Statistischen Bundesamtes bei den Bis-79-Jährigen mit 0,52 Prozent unter der durchschnittlichen Sterberate der letzten vier Jahre (0,54 Prozent).
08.04.2021 09:44:07 [Blätter]
Kampf gegen Corona: Die fatale Inkonsequenz
Es war ein folgenschweres Déjà-vu: So wie das Land im vergangenen Herbst in die zweite Coronawelle stolperte, so schauten die politisch Verantwortlichen nun viel zu lange zu, wie sich auf dem offenen Meer ein Corona-Tsunami aufbaute. Als habe es ringsum nicht erschreckende Beispiele schier explosionsartiger Corona-Ausbreitung gegeben, ließen sie sich von den hierzulande bis Anfang März sinkenden Infektionszahlen und den sich kurzzeitig leerenden Intensivstationen allzu bereitwillig blenden. Dabei war es nur eine Frage der Zeit, bis sich die infektiösere und tödlichere Coronavirusmutante B1.1.7 aus Großbritannien auch in Deutschland ausbreiten würde.
08.04.2021 11:11:13 [Junge Welt]
Grüne auf Regierungskurs: Offene Türen
Die Grünen haben die Ministersessel in Berlin fest im Blick. »Wir wollen das Land in die Zukunft führen«, und man kämpfe um die »Führung der nächsten Bundesregierung«, schreibt Michael Kellner, Bundesgeschäftsführer der Partei, in einem am Mittwoch bekanntgewordenen Brief an die Landesvorsitzenden und den Parteirat. In dem Schreiben teilt Kellner mit, dass die Partei am 19. April bekanntgeben will, wer von den beiden Parteivorsitzenden – also Annalena Baerbock oder Robert Habeck – die Kanzlerkandidatur für die Bundestagswahl übernehmen soll.
08.04.2021 11:29:20 [Telepolis]
Initiative für Corona-Impfpass ohne belastbare Daten?
Bundesgesundheitsminister Jens Spahn (CDU) hat seine Initiative für mehr Rechte für Geimpfte in der Corona-Pandemie offenbar ohne belastbare wissenschaftliche Daten ergriffen. Ein entsprechender Vorstoß, den Spahn in der Bild am Sonntag öffentlich gemacht hat, basiert nach Recherchen von Telepolis offenbar lediglich auf einer Kurzinformation des Präsidenten des Robert-Koch-Instituts (RKI), Lothar Wieler, vom 31. März. Das Dokument führt keine belastbaren Daten oder gar neuen Erkenntnisse an.

In dem zweiseitigen Schreiben vertritt Wieler die These, das Risiko einer Virusübertragung durch Personen, die vollständig geimpft wurden, sei "spätestens zum Zeitpunkt ab dem 15. Tag nach Gabe der zweiten Impfdosis geringer als bei Vorliegen eines negativen Antigen-Schnelltests bei symptomlosen infizierten Personen".

08.04.2021 14:51:06 [Blick nach rechts]
NPD will auf den Wahlzettel
Weitgehend unbeachtet von der Öffentlichkeit hat der Parteivorsitzende der NPD Frank Franz angekündigt, dass seine Partei am 26. September bei der Bundestagswahl antreten will. Über entsprechende Pläne für die neuen Länderparlamente in Sachsen-Anhalt, Thüringen und Mecklenburg-Vorpommern sowie für Abgeordnetenhaus in Berlin hüllen die „Nationaldemokraten“ sich hingegen in Schweigen. Verlesen mittels Teleprompter als Youtube-Nachricht kündigte der Parteichef die Wahlantrittsentscheidung als einen Bundesvorstandsbeschluss an, ohne weitere Einzelheiten zu nennen. Die Partei muss dafür ausreichend Unterstützungsunterschriften beibringen, worüber sie sich nun in kontaktvermeidenden Corona-Zeiten echauffiert.
08.04.2021 17:05:43 [NachDenkSeiten]
Geopolitischer Paukenschlag?
Zur Diskussion: Das mögliche Militärbündnis zwischen Russland und China. Am 4. Februar 2021 führten die Außenminister Russlands und Chinas, Sergej Lawrow und Wang Yi, ein Telefongespräch, dessen Bedeutung kaum zu überschätzen ist.

Im Rahmen der Neuunterzeichnung des Vertrages über Freundschaft und gute Nachbarschaft, der bald ausläuft, schlug Peking vor, den neuen Vertrag mit epochalen Inhalten zu füllen, die nicht nur den Wunsch beider Länder widerspiegeln, ihre eigene und die Sicherheit des jeweils anderen zu schützen, sondern auch die Sicherheit der Nachbarstaaten.

08.04.2021 18:51:48 [Verfassungsblog]
Der funktionsfähige Staat
Die „Funktionsfähigkeit des Gesundheitssystems“ ist zum Pauschalargument geworden, das die Freiheitsrechte dauerhaft zu untergraben droht. Gerichte dürfen dem Argument der Funktionsfähigkeit nicht dauerhaft nachgeben, sondern müssen wieder durchsetzen, dass der Staat so „funktioniert“, wie er zur Achtung der Grundrechte funktionieren sollte. Als Verwaltungsgerichte die ersten Lockdown-Maßnahmen des vergangenen Jahres auf ihre Verhältnismäßigkeit hin kontrollierten, gingen sie lehrbuchmäßig vor. Zur Rechtfertigung der massiven Eingriffe in die Freiheiten der Bürger verlangten sie vom Verordnungsgeber die Benennung legitimer Zwecke. Der Staat sollte sein Handeln angesichts der Intensität der Eingriffe gut begründen.
09.04.2021 06:30:33 [Post von Horn]
Laschet und Söder: Wenn zwei sich streiten
Die Union scheint von allen guten Geistern verlassen. Die Umfragewerte stürzten ab. Die Sperrminorität bei der Regierungsbildung ging verloren. Die Führung ist zerstritten. Sie schafft es nicht, eine gemeinsame Position zur Pandemie zu finden, leistet sich aber Machtkämpfe um Posten. Viele Anhänger haben das Theater der Hoffnungsträger Laschet und Söder satt und laufen zur Konkurrenz über. Die Union droht bei der Bundestagswahl ihre Führungsrolle im bürgerlichen Lager an die Grünen zu verlieren. Im Kampf gegen die Pandemie fordern CDU-Kanzlerin Merkel und CSU-Chef Söder Restriktionen. CDU-Chef Laschet torpedierte die Lockdown-Politik.
09.04.2021 06:49:59 [Neues Deutschland]
AfD-Bundesparteitag: Wer sind wir - und wenn ja, wie viele?
Die AfD streitet am Wochenende auf ihrem Bundesparteitag darüber, ob sie mit Spitzenkandidaten zur Bundestagswahl antritt. Würde sich die AfD an ihrem eigenen Anspruch orientieren, wäre die Angelegenheit klar, ein Streit unnötig: Allerorten betonen ihre Mitglieder, wie wichtig ihnen Basisdemokratie sei; die Partei fordert deshalb auch bereits seit Jahren Volksentscheide auf Bundesebene nach dem Vorbild der Schweiz. Kommen jedoch Machtinteressen mit ins Spiel, ist es schnell vorbei mit Basis, deren Votum und Willen.
09.04.2021 09:06:07 [Infosperber]
Massenmörder und Gestapo-Chef fast 20 Jahre im Dienste der CIA
Der SS-General und Komplize von Adolf Eichmann hat Zehntausende Juden in den Tod geschickt. Doch die CIA setzte ihn als Spion ein.

Erst jetzt zugängliche Archive der Geheimdienste der USA und Deutschlands brachten es ans Licht: Einer der schlimmsten Nazi-Massenmörder wurde am Ende des Zweiten Weltkriegs vor Verfolgung verschont und geschützt, weil er der CIA und auch dem deutschen Bundesnachrichtendienst BND nützlich war als Spion gegen den kommunistischen Osten.

Der «Report München» der ARD und die New York Times haben Auszüge aus den Geheimdienst-Dokumenten am Dienstag publiziert. Nur wenige grosse Medien berichteten bisher darüber.

09.04.2021 09:13:14 [Junge Welt]
Coronakrise: Sputnik-Schock in EU
Der Impfstoff »Sputnik V« wirkt. Politisch schon mal gegen die EU-weit verordnete Russen-Abwehr. Der EU-»Super«-Kommissar für Binnenmarkt und Industrie, Thierry Breton, hatte zum Beispiel im März verkündet, es gebe »absolut keinen Bedarf« für das russische Vakzin. Im osteuropäischen NATO-Aufmarschgebiet gegen Russland wird es ohnehin als Panzertarnung betrachtet. So halluzinierte die litauische Premierministerin Ingrida Simonyte kürzlich: »Putin kümmert sich nicht darum, den Impfstoff für sein russisches Volk zu nutzen. Er bietet ihn der Welt an als hybride Waffe, um uns zu spalten und zu beherrschen.«
09.04.2021 13:24:05 [Telepolis]
38 Jahre unrechtmäßig bespitzelt und überwacht
Wer die Homepage des Juristen und Publizisten Ralf Gössner anklickt, findet dort eine umfangreiche Dokumentation seiner jahrzehntelangen menschenrechtlichen Arbeit in der BRD. Dafür wurde er 38 Jahre lang von verschiedenen westdeutschen Geheimdiensten überwacht - grundgesetzwidrig wie das Bundesverwaltungsgericht Leipzig schon im Dezember 2020 feststellte.

Mittlerweile ist die Urteilsbegründung öffentlich. Nachdem alle Widerspruchs- und Revisionverfahren zurückgewiesen wurden, ist das Urteil rechtskräftig. Jetzt wurde Gössner also gerichtlich bestätigt, zu Unrecht beobachtet worden zu sein.

09.04.2021 14:50:41 [Verfassungsblog]
Kollektive Gefährdungslage Corona
Die Pandemie in der Asylrechtsprechung. Das Asylrecht schützt vor Gefahren im Herkunftsland. Im Rahmen nationaler Abschiebungsverbote nach § 60 Abs. 5 AufenthG werden dabei auch Gefahren berücksichtigt, die keinem konkreten Akteur zugerechnet werden können. Seit März 2020 müssen die Gerichte die sozio-ökonomischen Auswirkungen der Corona-Pandemie bewerten. Besonders deutlich wird das in Verfahren Schutzsuchender aus Afghanistan, für die bereits vor der Pandemie überproportional viele ablehnende Bescheide des Bundesamts für Migration und Flüchtlinge (BAMF) von den Verwaltungsgerichten korrigiert wurden.
09.04.2021 16:06:03 [Blog der Republik]
AfD-Parteitag: Vorspiel vor der großen Abrechnung
Parteitage der AfD sind selten das, was sie doch eigentlich sein sollen. Ein „Sozialparteitag“ war angekündigt, als sich mehr als 500 Delegierte Ende vorigen Jahres im niederrheinischen Kalkar trafen. Zwar beschlossen sie ein Papier zur Renten- und Gesundheitspolitik. Aber tatsächlich wird der Parteitag aus einem ganz anderen Grund in Erinnerung bleiben: weil einer ihrer beiden Bundessprecher ganz offen mit seinen Gegnern in der AfD abrechnete und weil die anderntags zum Gegenschlag ausholten.

Am kommenden Wochenende lädt die AfD erneut ihre Delegierten ein. Ein „Wahlparteitag“ soll es werden. Doch schon jetzt ist absehbar, dass es in den Dresdner Messehallen vor allem um die Frage gehen wird, wer in der Partei das Sagen hat.

09.04.2021 17:29:05 [Jacobin]
Wenn die Brandmauer fällt
Volkspartei der Mitte – so präsentiert sich die CDU am liebsten. Routinemäßig beteuert sie eine klare Distanzierung zu rechten Kräften wie der AfD. Tatsächlich hat die CDU der AfD den Weg geebnet. Und profitiert davon. Es darf rechts von der CDU/CSU keine demokratisch legitimierte Partei geben«, so hat es Franz Josef Strauß, Urvater und Leitfigur der CSU, gewollt. Dass mit der AfD dennoch eine solche Partei auf Bundesebene im Parlament vertreten ist, ist auch der Union selbst anzulasten.

Alexander Gauland, Jens Kestner, Tino Chrupalla, Stephan Brandner, Albrecht Glaser oder Martin Hohmann – die Liste der AfD-Funktionäre mit Unionsvergangenheit ist lang.

10.04.2021 06:34:49 [Novo Argumente]
Auf dem islamistischen Auge blind
Allahu Akbar, Gott ist groß! rufen sie. Über 200 Menschen sind gekommen, um an der Beisetzung eines jungen Mannes teilzunehmen, der wenige Tage zuvor, am 16. Oktober 2020, den französischen Lehrer Samuel Paty grausam getötet hatte. Hier in seiner Heimat im Nordkaukasus wird viel getrauert. Nicht um das Opfer und seine Angehörigen, sondern um den Mörder, der nach dem tödlichen Angriff von der Polizei erschossen worden war. Er ist ein Märtyrer für sie.

Nur wenige Tage zuvor hatte der Achtzehnjährige den 47-jährigen Lehrer nahe einer Schule im Pariser Vorort Conflans-Sainte-Honorine auf offener Straße enthauptet.

10.04.2021 08:41:43 [Der Freitag]
Demokratie: Verblödende K-Frage
Angela Merkel ist bald „weg“. Wird es ein Neuer richten? Warum ein Regierungswechsel noch lange kein Machtwechsel ist. Was alles von Angela Merkel erwartet und erhofft wird, könnte als Beweis gelten, dass im Stammhirn unserer Gesellschaft der Glaube an die Obrigkeit und die alles heilende Führung fest verwurzelt ist. Immer wieder braucht es eine Person, die durchgreift und nicht nur verwaltet. Die entscheidet und nicht diskutiert. Die vorangeht und sagt, wie es zu laufen hat. Und wenn uns diese Person enttäuscht, bekommt sie Etiketten aufgeklebt. „Die Aussitzerin“. Oder „Merkeldämmerung“. Diese Etiketten erzählen viel über uns.
10.04.2021 13:12:59 [RT DE]
Entrechtung zum Schutz der Bevölkerung?
Wenn Bevölkerungen "zu ihrem Schutz" entrechtet werden, dann drängen sich schlimme Vergleiche auf. Wenn man diese Vergleiche nicht ziehen darf, dann ist die Lage womöglich noch schlimmer als anfangs gedacht. Seit einem Jahr bekommen wir zu spüren, auf welch tönernen Füßen unsere "Grundrechte" offenbar stehen. Wirklich erstaunlich ist vor allem die Geschwindigkeit, mit der uns einige Politiker all das nehmen, was bis vor Kurzem noch als unveräußerlich galt. Und die spielerische Leichtigkeit natürlich, mit der dies geschieht. Nennenswerten Widerstand gibt es nämlich keinen.
10.04.2021 14:57:18 [ScienceFiles]
Unterwandert Soros die Judikative?
Von finanzierten Staatsanwälten und abhängigen Richtern. Korruption meint in der Regel die Käuflichkeit von Personen, die Positionen inne haben, die ihnen Entscheidungsmacht über bestimmte Ressourcen einräumt. In den 1980er Jahren war Korruption vor allem ein Phänomen, das mit Baudezernenten in Kommunen in Verbindung gebracht wurde, die von Bauunternehmern Geld und andere Geschenke angenommen haben und im Gegenzug die Auftragsvergabe so beeinflusst haben, dass die entsprechenden Bauunternehmer zum Zuge kamen.
10.04.2021 15:02:47 [Der Freitag]
Eine Republik des Bundes
Im Streit über die Corona-Maßnahmen wird der Föderalismus herausgefordert. Und mit ihm das Grundgesetz. Markus Söder hat recht: dass Angela Merkel und Armin Laschet, die Kanzlerin und der Parteivorsitzende der CDU, sich öffentlich miteinander anlegen – das geht gar nicht. Merkel wirft Laschet vor, er setze gemeinsam beschlossene Corona-Maßnahmen nicht um. Laschet lässt es nicht auf sich sitzen. Erst beruft er sich auf den Föderalismus, dann versucht er plötzlich, Merkel noch zu überbieten. Wie will so eine Partei die anstehende Bundestagswahl gewinnen?
10.04.2021 17:04:49 [Der Freitag]
Lauterbachs zweifelhaftes Lob
Der SPD-Gesundheitsexperte untermauert seine Forderung nach Ausgangssperren mit Verweis auf eine Studie, die sich näher zu betrachten lohnt. In der Debatte um Ausgangssperren wird immer wieder der Preprint der Studie "Understanding the effectiveness of government interventions in Europe’s second wave of COVID-19" zitiert. Inwiefern zeigt diese Untersuchung mehr als eine Korrelation? Gibt es diesen Zusammenhang zwischen Ausgangssperren und sinkendem R-Wert, also ist dieser auch kausal, oder gibt es möglicherweise Randbedingungen, die viel entscheidender sind? Um diese Fragen zu beantworten, hilft ein genauer Blick in den Begleittext der Studie.
10.04.2021 18:46:09 [Der Freitag]
Ausgangssperren sind sinnlos
Angesichts steigender Fallzahlen und dem exponentiellem Wachstum der Virusmutation B 1.1.7 in Deutschland diskutiert auch die Bundesregierung über Ausgangssperren. Angela Merkel meint: „Ausgangsbeschränkungen können ein ganz wirksames Mittel sein.“ Und Karl Lauterbach (SPD) ist sich sicher: „Portugal hat durch einen kurzen harten Lockdown B117 besiegt und bisher keinen Rückfall. War vorher Hotspot der Welt. Ausgangssperren in allen stärker betroffenen Regionen waren ein zentraler Bestandteil.“ Stimmt das? Sind Ausgangsbeschränkungen tatsächlich ein wirksames Mittel?
10.04.2021 18:48:00 [Tichys Einblick]
Die Welt als Waldspaziergang – über das grüne Menschenbild
Die Grünen regieren in Deutschland gefühlt seit Jahren schon mit. Offenbar empfinden sie das auch selbst so: Nur die Anhänger der Koalitionsparteien CDU/CSU und SPD sind mit der Politik von Angela Merkel so zufrieden wie die Anhänger der Grünen. Und die Forderung der Kanzlerin nach einem härteren Lockdown unterstützen sogar ungefähr genauso viele Grüne wie Unionisten, während selbst sozialdemokratische Wähler da viel skeptischer sind. Bei den kommenden Bundestagswahlen soll aus der gefühlten Regierungspartei eine tatsächliche werden. Die Grünen streben ins Kanzleramt. Dort wird zwar schon länger inhaltlich grüne Politik gemacht, aber eben noch nicht formal.
10.04.2021 18:53:34 [Telepolis]
NRW-Linke wählt Wagenknecht auf ersten Listenplatz
Sahra Wagenknecht soll trotz scharfer Kritik aus den eigenen Reihen die nordrhein-westfälische Landesliste der Partei Die Linke für die Bundestagswahl im September anführen. Mehr als 60 Prozent der Delegierten hätten sich für Wagenknecht auf dem ersten Platz der NRW-Liste ausgesprochen, teilte der Landesverband am Samstag mit.

Auf den zweiten Listenplatz wurde mit knapp 85 Prozent der Stimmen der Bundestagsabgeordnete und Rentenexperte Matthias W. Birkwald gewählt, auf Platz drei mit 58,17 Prozent Sevim Dagdelen, die ebenfalls schon der Bundestagsfraktion angehört und diese als Obfrau im Auswärtigen Ausschuss vertritt.

11.04.2021 07:01:00 [Blog der Republik]
Raubtierkapitalismus par excellence
Die Nebel lichten sich. Die ubiquitär ob ihrer chaotischen Impfstoff-Ankaufstrategie gescholtene EU-Kommission samt deutschem Gesundheitsminister Spahn scheint, vorerst, nicht mehr das Ziel der Kritik zu sein. Investigative Journalisten von NDR, WDR und „Süddeutscher Zeitung“ haben herausgefunden, wie es sich wirklich zugetragen hat: Brüssel, Berlin und andere EU-Länder haben im Sommer 2020 nicht sofort Dosen in großem Stil eingekauft, weil die Herstellerfirmen Biontech/Pfizer astronomische Preise verlangt hatten: 54,08 Euro pro Dosis. Offenbar dachten die Erzeuger, sie könnten sich eine goldene Nase verdienen.
11.04.2021 07:03:50 [Die Kolumnisten]
Willkommen im Behördendschungel
In Deutschland ist alles geregelt? Ja, aber nicht alle Regeln passen zusammen. Wer es mit der deutschen Bürokratie zu tun bekommt, der kann was erleben. Das zeigt die Geschichte eines Asylbewerbers, der zwischen die Mühlen von BAMF, Jobcenter, Familiengericht, Jugendamt und Ausländeramt geriet und nun doch so seine Zweifel am hochgelobten Rechtsstaat hat. Da feiert Kafka fröhliche Urständ.

Nennen wir ihn Herrn N. Herr N. kam bereits vor ein paar Jahren als Asylsuchender nach Deutschland. Herr N. kommt aus Afrika. Er floh dort vor Gewalt. Er spricht Englisch, was allerdings wegen seiner ganz besonderen Aussprache zunächst gar nicht auffällt.

11.04.2021 07:22:29 [Deliberation Daily]
Eine Woche im Leben der Saskia Esken – Pleiten, Pech & Pannen
Es läuft nicht für die SPD. Während die politische Konkurrenz schwächelt, schaffen es die Erben Helmut Schmidts, sich in Selbstbespiegelungen zu ergehen. Auslöser ist diesmal ein Essay des früheren Bundestagspräsidenten Wolfgang Thierse, der versöhnerisch auch auf der Linken Auswüchse von Cancel Culture und Identity Policys konstatierte. Auf diesen Affront gegenüber den sektiererischen Milieus der LGBT-/ Gendersternchengruppen reagierte die Parteispitze ihrerseits mit dem Canceln des früheren Bürgerrechtlers der DDR. Zwischenstand: Thierse stellt die Vertrauensfrage, ob er eine Person sei, der sich die SPD schämen müsse. In diesem Falle liegt sein Austrittsschreiben in der Schublade.
11.04.2021 07:28:39 [Tichys Einblick]
„Verfassungsrechtlich nicht geregelter Ausnahmezustand“
Der Verfassungsrechtler Ulrich Vosgerau äußert sich zu den Plänen der Bundesregierung, über eine Änderung des Infektionsschutzgesetzes bundesweit Ausgangssperren einzuführen. Verwaltungsgerichte seien ihrem "verfassungsrechtlichen Auftrag nicht nachgekommen". TE: Wie ist dieser neue Entwurf der Bundesregierung aus juristischer Perspektive zu bewerten? Wird hier nicht der mit Ewigkeitsklausel verankerte Föderalismus angegriffen?

Was das Infektionsschutzgesetz angeht, so ist in Art. 74 Abs. 1 Nr. 19 GG eine konkurrierende Gesetzgebungszuständigkeit des Bundes in Hinblick auf „Maßnahmen gegen gemeingefährliche oder übertragbare Krankheiten“ vorgesehen.

11.04.2021 09:55:42 [Legal Tribune Online]
"Wie das Grund­ge­setz hier igno­riert wird, ist ein­zi­g­artig"
Für Enteignungen vor 218 Jahren erhalten die Kirchen noch heute jährlich Millionen vom Staat - obwohl das Grundgesetz das Ende der Zahlungen gebietet. Warum der Gesetzgeber endlich handeln muss, erklärt Claus Dieter Classen im Interview.

LTO: Auch im Jahr 2020 bekamen evangelische und katholische Kirche von den Steuerzahlern über die Bundesländer rund 570 Millionen Euro jährliche Entschädigungen für Enteignungen aus dem frühen 19.Jahhundert überwiesen. Für was wird da immer noch entschädigt? Prof. Dr. Claus Dieter Classen: Historischer Hintergrund der heute gezahlten Staatsleistungen ist insbesondere der Reichsdeputationshauptschluss von 1803.

11.04.2021 11:50:54 [Klaus Peter Krause]
Den verordneten Lockdown sofort beenden
Die AfD hat auf ihrem Bundesparteitag in Dresden am 10. April haben die Delegierten eine Resolution gegen die freiheitsbeschränkenden und grundgesetzwidrigen Coronavirus-Anordnungen beschlossen. Die AfD Sie will damit „einen Weg zurück in die Normalität“ aufzeigen. In der Resolution fordert sie die Bundes- und Landesregierungen zu folgenden neun Maßnahmen auf. 1.) Es sei ein breiter wissenschaftlicher und öffentlicher Diskurs zuzulassen. In ihm müssten auch renommierte Wissenschaftler mit abweichender Meinung zum Umgang mit der derzeitigen Situation gleichwertig zu Wort kommen. Gelegenheit dazu gäbe ein unabhängiges Expertengremium. In ihm müssten nicht nur Virologen und Epidemiologen, sondern auch Psychologen, Soziologen, Ökonomen und Verfassungsrechtler vertreten sein und auch gehört werden.
11.04.2021 13:26:46 [Der Freitag]
Die Einzelgängerin
Porträt: Ursula von der Leyen wird vorgeworfen, als EU-Kommissionspräsidentin zu abgeschottet und abgehoben zu sein. Für Einheit innerhalb der EU zu sorgen, ist für eine Präsidentin der Brüsseler Kommission nicht einfach. Ursula von der Leyen aber hat es geschafft, dass zwei konträre Zeitgenossen plötzlich harmonieren. Als ihr Vorgänger Jean-Claude Juncker jüngst die verfehlte Impfstrategie der EU ins Visier nahm, löste das bei Dominic Cummings, Ex-Berater von Boris Johnson und Chefarchitekt des Brexits, einen anerkennenden Tweet aus. „Juncker hat recht“, schrieb die einstige Galionsfigur der Kampagne: „Die EU verlassen!“
11.04.2021 15:19:12 [Der Freitag]
Die Klassenspaltung innerhalb der Linken
Parteistreit: Der innerparteiliche Kampf innerhalb der Partei Die Linke ist ein Konflikt zwischen verschiedenen Klassen-(Fraktionen). Im Zusammenhang um die Kandidatur Sahra Wagenknechts für den Listenplatz Nummer 1 auf der LINKEN-Landesliste zur Bundestagswahl und ihrem bald erscheinendem Buch „Die Selbstgerechten“ entzündet sich erneut die Diskussion um die Rolle von Identitätspolitik innerhalb linker Politik und der Strategie der Partei Die Linke. Die Positionen Wagenknechts und die ihrer Kritiker sind für alle in dutzenden Stellungnahmen und Social-Media Beiträgen einzusehen und brauchen hier nicht wiederholt werden.
11.04.2021 16:48:38 [Neues Deutschland]
Bundesparteitag der AfD: Kopflos, aber radikal mit Höcke
EU-Austritt, Migrationsstopp, Antifa-Verbot: AfD beschließt ein extrem rechtes Wahlprogramm. Ausgelassene Familienfeiern, ein Gartenzwerg, der Hund fährt auf einem Automatikstaubsauger durchs Wohnzimmer: In ihrem Kampagnenfilm zur Bundestagswahl wirbt die AfD mit einer Bildsprache, die an das kleinbürgerliche Spießerdeutschland appelliert. Dieses verschanzt sich – ebenfalls in dem Werbeclip zu sehen – hinter einem frisch gestrichenen Gartenzaun vor der Welt da draußen. Dort lauern, so suggeriert es der Film im Kontrast zur gezeigten Biedermeieridylle, nur Kriminelle, die Antifa und eine von Berlin aus gesteuerte »Corona-Diktatur«. Die Lösung? »Deutschland. Aber normal«, so der AfD-Wahlslogan zur Bundestagswahl.
11.04.2021 16:56:29 [Unsere Zeit]
Den Irrationalismus als Politik verkaufen
Der Entwurf des Wahlprogramms von Bündnis 90/Die Grünen ist im Verhältnis zu seiner Umsetzung so relevant, wie es eben Parteibeschlüsse für diejenigen Parteigranden sind, denen – aus gutem Grund – in aller Regel die Mikrofone vorgehalten werden. Wichtige Beschlüsse der Partei per „Tagesschau“ oder „Heute“ in Frage zu stellen, zu verdrehen oder gar völlig umzukehren – darin unterschieden sich die Medienlinken Schröder, Fischer oder Gysi nicht; auch nicht darin, mit Rücktritt oder Nichtwiederkandidatur zu drohen, falls „die Partei“ auf der Beschlusslage bestünde. Eine grün geführte Bundesregierung wird das Pendant der Biden-geführten US-Regierung sein. Und sie werden es schaffen, dass wir Merkel und Trump noch vermissen.
11.04.2021 17:03:02 [Telepolis]
„Die AfD ist Teil des Eigentümerblocks“
Beim AfD-Bundesparteitag an diesem Wochenende in Dresden dürfte es über ein Politikfeld wenig Streit geben - die Wohnungs- und Mietenpolitik. Da ist die AfD Teil des Eigentümerblocks, wie es kürzlich Gerd Wiegel in einer Online-Diskussionsveranstaltung des Bildungsvereins Helle Panke zusammenfasste.

Wiegel, der Herausgeber des Buches "Rechtspopulisten im Parlament. Polemik, Agitation und Propaganda der AfD" erklärte, dass bei der AfD, so zerstritten sie auch sonst ist,in der Ablehnung jeglicher mieterfreundlicher Maßnahmen kein Dissens bestehe.

11.04.2021 19:00:11 [Telepolis]
Söder und Laschet zur Kanzlerkandidatur bereit
Wen schickt die Union ins Rennen? Die Ministerpräsidenten von Nordrhein-Westfalen und Bayern haben ihre Hüte in den Ring geworfen. Ein der Redaktion bekannter hessischer SPD-Landtagsabgeordneter witzelte schon mehrfach, es sei doch egal, welcher Unionspolitiker im September das Rennen um die Kanzlerschaft gegen Olaf Scholz verliert. Tatsächlich deuten die Umfragewerte der SPD nicht darauf hin, dass Finanzminister Scholz eine Chance hat, Kanzler zu werden, denn seine Partei liegt aktuell nur bei 15 Prozent. Die Unionsparteien haben mit 27 Prozent die Nase vorn, ihre schärfsten Konkurrenten für die kommende Bundestagswahl sind zur Zeit mit 23 Prozent die Grünen.
 Sport (49)
01.04.2021 09:23:52 [Neues Deutschland]
FC Bayern: Unvorbereitet in den Titelkampf
Dem FC Bayern fehlt der Beste, RB Leipzig stimmt seine Nationalspieler virtuell auf das Spitzenduell ein. Dass der Fußballzwerg Andorra einen Einfluss auf den Ausgang der Deutschen Meisterschaft haben könnte, war vor einigen Tagen auch noch nicht abzusehen. Doch weil Albert Alavedra Jimenez vom spanischen Drittligisten Pobla de Mafumet im Qualifikationsspiel zur WM 2022 zwischen Polen und dem 75 000 Einwohner zählenden Zwergstaat seinem Gegenspieler Robert Lewandowski unglücklich aufs Knie fiel, fehlt der nun wochenlang.
01.04.2021 09:25:32 [Süddeutsche Zeitung]
Auf nach Harrogate
In England wird erstmals eine Schiedsrichterin ein Profispiel der Männer pfeifen - in Liga vier. Das Mutterland des Fußballs hinkt der weltweiten Entwicklung hinterher. Spektakel hat Englands Männerfußball auch am Osterwochenende zu bieten, etwa wenn Arsenal, derzeit Neunter, in London den entthronten Meister FC Liverpool empfängt. Doch zum eigentlichen Match, das "Geschichte schreibt", wie die Times verkündet, ist eine Landpartie vonnöten. Raus aus der Metropole, vier Stunden die M1 nach Norden, Richtung Yorkshire Dales, wo am Rand von Tälern und Hügelketten der alte Kurort Harrogate liegt. Der dortige Fußballklub, Harrogate Town, residiert an der Wetherby Road in einem Stadion mit 3800 Plätzen.
01.04.2021 09:26:57 [11 Freunde]
Unterm Sarg­de­ckel
Rot-Weiss Essen wird auch nächste Saison nicht in der 3. Liga spielen. Eine trau­rige Nach­richt für Fuß­ball­ro­man­tiker und ein wei­terer Beleg für den Fehler in der Liga-Hier­ar­chie: Wer nach der Regio­nal­liga-Reform 2008 aus der Dritt­klas­sig­keit abstieg, ist ver­dammt. In der 93. Minute beer­digte Sven Kreyer die Auf­stiegs­hoff­nung von Rot-Weiss Essen. Per Elf­meter traf der ehe­ma­lige Essener, nun in Diensten von Rot-Weiß Ober­hausen, zum 1:1‑Ausgleich. Die zweite Mann­schaft von Borussia Dort­mund auf Tabel­len­platz eins der Regio­nal­liga West hat nun neun Punkte Vor­sprung – und punktet die Saison über sehr kon­stant.
01.04.2021 09:28:26 [TAZ]
Politische Protestfolklore
Der Profisport wird zur Bühne für Gesellschaftskritik. Mittlerweile organisieren die Verbände selbst die Proteste. Man kann das absurd finden. Der Profisport ist weiter im Protestmodus. Es wird fleißig gekniet, und immer häufiger finden sich politische Botschaften auf Sporttextilien, die von Profis in die Arenen getragen werden. Aus dem wütenden Protest einzelner Sportler ist längst eine Art Ritus geworden. Die Verbände selbst sind es, die die Botschaften auf der Wäsche ihrer Athleten auftragen.

So sind nun nach den Fußballverbänden Norwegens und Deutschlands auch dänische und belgische Nationalspieler mit Appellen für Menschenrechte auf ihren Aufwärm-T-Shirts ins Stadion geschickt worden.

01.04.2021 09:30:05 [Zeit Online]
Sturm Graz
: Der zwölfte Mann
Der Fußball hat sich an Geisterspiele gewöhnt. Nur nicht in einem Stadion in Österreich. Dort unterbricht ein einziger Fan die Stille, vom Fenster seiner Wohnküche aus. Wer in Österreich ein vibrierendes Fußballstadion erleben wollte, der musste nach Graz. Im 1997 eröffneten Hexenkessel besiegte der kleine Verein mit seinen Fans im Rücken so manches Spitzenteam. Olympique Marseille, Galatasaray Istanbul oder die Glasgow Rangers haben hier verloren. Bei diesen Sensationen war die Arena im Stadtteil Liebenau stets bis auf den letzten Platz gefüllt.
01.04.2021 09:32:09 [Junge Welt]
Glänzte auch als Achter
(Info: Hardy Grüne/Dietrich Schulze-­Marmeling (Hg.): D10S. Diego Maradona. Ein Leben zwischen Himmel und Hölle, Verlag Die Werkstatt, Bielefeld 2021, 160 Seiten, 29,90 Euro) Der neue Text-Bild-Band »D10S« bemüht sich, Maradona gerecht zu werden. »Diego ist der Bannerträger aller, die von unten kämpfen. Der Engagierten, Bescheidenen, der Barrios, des Fortschritts«, so der argentinische Illustrator Diegolan Dibujos. So könnte es weitergehen in einem neuen Text-Bild-Band mit dem Titel »D10S«: Bei Diego verschmolz die 10 oft mit »dios« (Gott). Doch über 90 Minuten, die sich in den 15 Beiträgen stöbern lässt, ist das Tempo kaum zu halten.
01.04.2021 09:35:09 [Kontext Wochenzeitung]
Von Pfeifen und Super-Pfeiffen: Flieg, Albatross, flieg!
Wo findet man einen Möchtegern-Fußballpräsidenten? Aber klar doch: beim CDU-MdB Joachim Pfeiffer, der in seinem Wahlkreisbüro allerlei Geschäfte betreibt. Laschet und Lindner, Scheuer und Spahn, vor lauter covidösem Irrsinn kommt man aus dem Kopfschütteln kaum raus. Fährt seine eigenen Drinnenkontakte gegen Null, predigt den Kindern, es ebenso zu machen. Was sonst sollte man denn auch tun, sich über alles aufregen, was einem auch nach 14 Monaten Pandemie immer noch fast minütlich an Schwachsinn begegnet? Und weil das hier eine Sportkolumne ist, werde ich mich also beschränken und zuvorderst über Schwachsinn aus der Welt des Sports aufregen.
01.04.2021 09:38:11 [WOZ - Die Wochenzeitung]
WM-Boykott? «Schweigen ist keine Option mehr»
Am Anfang stand ein norwegischer Exfussballprofi – jetzt breitet sich die Bewegung für einen Boykott der Fussball-WM 2022 in Katar rasant aus. Doch bringt so ein Boykott überhaupt etwas? Und wie verhält sich die Schweizer Nati, deren Hauptsponsor in Katar Milliardeninteressen verfolgt? Tom Hoglis fussballerische Sternstunde kam, als der norwegische Aussenverteidiger im Sommer 2011 auf den portugiesischen Superstar Cristiano Ronaldo traf: CR7 sah neunzig Minuten lang kaum einen Ball – und war sichtlich genervt.

Hoglis aktivistische Sternstunde ist jetzt gekommen: Auf seine Initiative hin begann sich der Fussballklub Tromsö IL, bei dem Hogli inzwischen als Funktionär arbeitet, beim norwegischen Fussballverband für einen Boykott der WM in Katar einzusetzen.

01.04.2021 09:40:37 [Süddeutsche Zeitung]
DFB-Elf in der WM-Qualifikation: Zurück im Trauma
Gerade erst hat sich die deutsche Mannschaft vom Spanien-Debakel erholt, da kommt der nächste kapitale Rückschlag: ein 1:2 gegen Nordmazedonien, den 65. der Weltrangliste. Eigentlich hätten die Fußballer der deutschen Mannschaft bereits stutzig werden müssen, als sie vor dem Anpfiff die Nordmazedonier neben sich ihre Hymne haben singen hören: nicht schön, aber umso inbrünstiger. Und genau so haben sie dann auch gespielt.

Man hatte ja irgendwie gedacht, Ilkay Gündogan und den Seinen gelingt zurzeit alles. Der 30-Jährige spielt bei Manchester City in der Form seines Lebens, schießt dort Tore am Fließband und ist am Mittwochabend für die deutsche Nationalmannschaft sogar als Kapitän aufgelaufen.

01.04.2021 13:11:32 [Zeit Online]
Nationalmannschaft: Noch eine historische Niederlage
Deutschland verliert sensationell gegen Nordmazedonien. Seine letzte Etappe als Bundestrainer wird wohl doch keine lockere Ehrenrunde für Jogi Löw. Oje, Timo Werner. Der eingewechselte Stürmer vergab in der 80. Minute (es stand noch 1:1) die Führung auf derart unelegante Art, dass sie den Fußballfans noch lange im Gedächtnis bleiben wird. Leeres Tor, elf Meter Entfernung: Auch das Internet wird diese verstolperte, verstümperte Chance nie vergessen. Der arme Werner muss nun bei manchen als Sinnbild für Deutschland und das Impfscheitern herhalten. Das wird ihm nicht gerecht, die Kreisligavergleiche allerdings schon. Wobei sich die Kreisligen gegen Werner-Vergleiche wehren dürften.
03.04.2021 08:47:19 [Süddeutsche Zeitung]
Olympische Spiele: "Überhaupt nicht sicher"
Trotz steigender Infektionszahlen halten die Organisatoren an den Spielen in Tokio fest. Während die japanische Regierung auf ihr Corona-Management vertraut, warnen Fachleute eindringlich. Der Freitag war ein schlechter Tag für Yoshihide Suga, den Premierminister des Olympia-Gastgebers Japan. Die Nachrichtenagentur Kyodo meldete, Suga habe wegen der neuen Infektionszahlen eingelenkt und werde den neu eingeführten Status "Semi-Notstand" über Osaka und zwei weitere Präfekturen, Hyogo und Miyagi, verhängen. Die Entscheidung ist das indirekte Eingeständnis Sugas, dass seine Coronavirus-Politik nicht vor einem Anstieg der Infektionszahlen schützt.
03.04.2021 08:48:59 [Frankfurter Allgemeine Zeitung]
Dortmund gegen Frankfurt: Das kleine Gipfelduell der Bundesliga
Bevor sich Leipzig und die Bayern zum Topspiel treffen, schaut die Liga nach Dortmund, wo die Eintracht im Kampf um die Champions League antritt. Es ist auch das Duell der zweitbesten Torjäger. Die Bilanz ist verheerend. Für den Start in den „Monat der Wahrheit“, wie Eintracht-Trainer Adi Hütter die Herausforderungen im April bezeichnet hat, ist der Blick zum kommenden Gegner nach Dortmund wenig verheißungsvoll. Bundesligaspiele im größten deutschen Fußballstadion weisen seit vielen Jahren schon eine Regelmäßigkeit auf: Für die Eintracht sind sie beim BVB allesamt verlorengegangen.
03.04.2021 08:50:13 [Schwatzgelb]
Mitmachen oder zugucken?
Am kommenden Dienstag gastiert der berühmte Ballspielverein Borussia aus Dortmund bei einer der besten Mannschaften der Welt, Manchester City. Es ist das Viertelfinale des wichtigsten europäischen Wettbewerbs, der Champions League, das Hinspiel mit viel Prestige, Stolz und auch wirtschaftlicher Bedeutung. Denn wer im Konzert der Großen mitspielen will, muss in der Champions League dabei sein und am besten auch noch einige der zu holenden Prämien abgreifen. Doch damit solche Abende wie kommenden Dienstag auch noch in der kommenden Saison nötig sind, braucht es – neben der nur theoretischen Möglichkeit eines Titelgewinns in der Champions League – wichtige Punkte in der Bundesliga.
03.04.2021 08:51:27 [Süddeutsche Zeitung]
Bundestrainer: Jetzt erst recht!
Einst, als Felix Magath noch unten an der Seitenlinie stand, galt er als engagierter Anwalt seiner Zunft. Seiner damaligen Auffassung nach war der Trainer das schwächste Glied in der Nahrungskette des Fußballs. Er selbst drückte es drastisch aus, und angesichts der Debattenlage sei es, trotz der Osterruhe, kurz wiederholt: "Der Trainer ist hier doch immer der letzte Arsch."

Heute, mit 67, sitzt der einstige Meistercoach des FC Bayern und des VfL Wolfsburg auf der Tribüne weiter oben. Allerdings muss er die Tabelle, will er sofort seinen aktuellen Arbeitgeber finden, von unten lesen.

03.04.2021 08:52:51 [TAZ]
Hauptstadt-Club mit Defiziten: Ach, Hertha!
Unter den Fußballvereinen gilt Hertha BSC als die wenig geliebte graue Maus. Warum schafft es der Club einfach nicht, positive Gefühle auszulösen? Entgegengebrachter Hass ist für einen Fußballverein gar nicht so schlimm. Der FC Bayern München beispielsweise wird in Deutschland von vielen innigst gehasst, und der Verein lebt ganz gut damit. Hertha BSC löst bei sehr vielen dagegen nur hochgradig indifferente Emotio­nen aus. Deutschlandweit, aber auch in der Hauptstadt selbst: der Verein ist irgendwie einfach nur egal. Es kursieren zig Rankings mit den beliebtesten bzw. unbeliebtesten Bundesliga-Vereinen: Die Hertha gehört bei diesen zuverlässig zu den am wenigsten angesagten Clubs.
03.04.2021 08:54:07 [Neues Deutschland]
Friede den Kurven, Krieg den Verbänden
Zuschauer, Stimmung, Emotionen: All das fehlt seit fast einem Jahr im Fußballkosmos. Und doch geht das Spiel weiter. Weil es von Fernsehgeldern und oft von Millionen der Investoren lebt, nicht von den Fans auf der Tribüne. Wo die Prioritäten im modernen Fußball liegen, führte jüngst auch die ZDF-Dokumentation »Der Prozess. Wie Dietmar Hopp zur Hassfigur der Ultras wurde« vor: Milliardäre werden geschützt, kritische Fans drangsaliert, der Deutsche Fußball-Bund (DFB) möchte sie am liebsten ganz aus den Stadien vertreiben. Denn Ultras und aktive Fans stehen der kommerziellen Weiterentwicklung im Weg, sie wehren sich gegen die RB Leipzigs und die Dietmar Hopps, aber das vergangene Jahr und die Dokumentation zeigen: Sie sind machtlos.
03.04.2021 08:56:03 [N-TV]
Wilde Storys um die Rote Karte
Die Rote Karte in der Bundesliga feiert heute ihren 50. Geburtstag. Am 3. April 1971 flog mit Friedel Lutz der erste Spieler vom Feld, nachdem er den roten Karton gesehen hatte. Doch dieser spektakuläre Platzverweis war bei weitem noch nicht der wildeste in der langen Liga-Geschichte!

"An jenem Samstag muss mich der Teufel geritten haben!" Das sagte der erste Rotsünder der Fußball-Bundesliga, Friedel Lutz, eine Woche nach seinem spektakulären Platzverweis in der Partie seiner Frankfurter Eintracht gegen das Team aus Braunschweig am 3. April vor genau fünfzig Jahren.

03.04.2021 08:57:54 [Süddeutsche Zeitung]
Vor dem Spitzenspiel gegen Leipzig:Bayern schaltet in den Trotzmodus
Der Tabellenführer will den Verletzungsfrust rund um Robert Lewandowski hinter sich lassen - doch Trainer Flick muss nicht nur an der Besetzung im Sturm tüfteln. Eine gute Nachricht gab es für den FC Bayern mit Blick auf diese vermaledeite Länderspielwoche dann doch. Es hat sich nach gesicherten Erkenntnissen bayerischer Rechercheure immerhin kein weiterer Münchner verletzt. Die Kimmichs, Goretzkas und Gnabrys dürften nach dem 1:2 des DFB gegen Nordmazedonien zwar alle mit einer ordentlichen Stimmungsdelle aus Duisburg zurückkehren, aber sie kommen mit heilen Knochen.
04.04.2021 09:17:49 [N-TV]
"Fußball überschätzt seine Bedeutung total"
Wann wieder Zuschauer in deutsche Fußballstadien strömen dürfen, ist völlig offen. Trendforscher Eike Wenzel glaubt aber, dass die Fans bald die Liebe für ihren Lieblingssport verlieren könnten. Weil der dringend notwendige Veränderungen nicht angehe und sich selbst überschätze.

Trendforscher Eike Wenzel hat die Eigenwahrnehmung und das Selbstbild im Fußball kritisiert. "Der Fußball überschätzt sich in seiner Bedeutung total", sagte der 54-Jährige dem "Tagesspiegel" in einem Interview. "Inzwischen denken viele der Protagonisten, er sei tatsächlich systemrelevant. Wenn die Bundesliga im vergangenen Frühling richtig gestoppt worden wäre, hätten sie das Fernsehen gleich auch dichtmachen können."

04.04.2021 09:19:29 [Süddeutsche Zeitung]
1. FC Köln: Von Endspiel zu Endspiel
Der 1. FC Köln bestreitet derzeit so viele Endspiele, dass bei seinen Anhängern schöne und zugleich irreführende Erinnerungen geweckt werden könnten. An die Achtziger Jahre zum Beispiel, als die Geißböcke noch selbstbewusst durch den Uefa-Pokal galoppiert und erst im Finale den spanischen Giganten von Real Madrid unterlegen waren. Die Endspiele moderner Prägung hingegen sind ein stark personenbezogenes Ereignis, in dem es vornehmlich um die Frage geht, ob Markus Gisdol weiter Trainer des FC bleiben darf - so lautete zumindest so manche mediale Zuspitzung in den vergangenen Wochen.
04.04.2021 09:21:15 [Deutschlandfunk]
Spielfeld für Separatismus
In einigen Regionen Spaniens dient der Fußball als emotionale Kulisse für das Streben nach Unabhängigkeit. Im Baskenland ist der Traditionsklub Athletic Bilbao Symbol für Eigenständigkeit. Der Verein ist eng mit der Politik verbunden und setzt ausschließlich auf Spieler mit baskischen Wurzeln. Im San Mamés, dem Stadion von Athletic Bilbao, gehört das Vereinsmuseum zu den Attraktionen. Auf einer Videowand scheppert eine Dampflok durchs Bild. Hochöfen, Schiffsirenen, hart arbeitende Männer. Der Film erinnert an das späte 19. Jahrhundert, als Bilbao zu den wichtigsten Industriestandorten zählte. Britische Einwanderer gründeten Athletic 1898 mit einem englischen Klubnamen, erzählt Museumsdirektor Asier Arrate.
04.04.2021 09:24:13 [Fliegende Bretter]
Duisburger Nächte
Wer glaubte, nach dem 0 : 6 gegen Spanien (wir berichteten) sei der vorläufige Tiefpunkt hiesiger nationaler Fußballkunst erreicht, sah sich am Mittwochabend eines Anderen belehrt. Mit 1 : 2 verloren Jogis Jungs in Duisburg gegen Fußballgigant und Favoritenschreck Nordmazedonien. Wie fängt man da an? Am besten, indem man versucht, der Sache Positives abzugewinnen: Dem DFB und der von ihm betreuten Fußball-Nationalmannschaft der Herren muss man attestieren, vieles richtig zu machen zur Zeit. Dank deren Arbeit dürfte nämlich die Boykottkampagne gegen die absurde, für 2022 angesetzte Weltmeisterschaft in Katar ein voller Erfolg werden. So das Nationalteam sich überhaupt qualifiziert, dürften auch die schwarzrotgeilsten Hardcore-Fans und Kfz-Beflagger nur wenig geneigt sein, sich bei Glühwein und Lebkuchen irgendwelche verzweifelten Grottenkicks anzutun. Es sei denn, sie haben eine masochistische Ader.
04.04.2021 09:25:57 [Süddeutsche Zeitung]
FC Bayern: Ein Sieg wie aus alten Zeiten
Der FC Bayern spielt gegen Leipzig wie das Gegenteil der Nationalmannschaft: Kalt, effizient und mit ein bisschen Glück. Besonders der Eifer von Thomas Müller erweist sich als kostbar. Julian Nagelsmann ist, wie man so sagt, ein Taktikfuchs, er ist immer für Überraschungen gut. Aber dieser Trick wäre dann doch neu: einfach ein Loch ins linke Außennetz schneiden lassen und damit Manuel Neuer verwirren. Mit vierminütiger Verspätung begann das Topspiel des 27. Bundesliga-Spieltags, es musste erst ein Mann vom Heimwerker-Service kommen, um mit zwei Kabelbindern die Maschen zu flicken.
04.04.2021 09:27:46 [Schwatzgelb]
Auf dem Weg in die Königsklasse irgendwo falsch abgebogen
Im direkten Duell um Platz vier besiegt Eintracht Frankfurt den BVB mit 1:2 (1:1). Die Teilnahme an der Champions-League rückt für die Borussia somit in immer weitere Ferne. Dortmund. Karsamstag. 15:30 Uhr. Bestes Fußball-Wetter. Die Voraussetzungen für einen ordentlichen Fight um Platz vier sind also erste Sahne. Der Tabellen-Fünfte Borussia Dortmund trifft im heimischen Westfalenstadion auf die Eintracht aus Frankfurt. Klingt doch alles nach einem herrlichen Fußball-Nachmittag.

Nach dem enttäuschenden 2:2 in Köln nahm BVB Coach Edin Terzic insgesamt vier Änderungen an seiner Startelf vor: Statt Reyna, Meunier, Brandt und Dahoud, durften nun Akanji, Reus, Geurreiro und Delaney von Beginn an ran.

05.04.2021 11:41:31 [Süddeutsche Zeitung]
Zweitligist Hamburger SV: Der nächste Kapitalpatzer
Der HSV bleibt das Klischee seiner selbst - und verspielt im Nordderby gegen Hannover eine 3:0-Führung. Wiegt die Last, aufsteigen zu wollen, tatsächlich so schwer? Ist es ein dunkler Fluch? Einfach nur Unvermögen? Oder liegt auf einem Fußballer wirklich eine zentnerschwere Last, sobald er sich das traditionsreiche Trikot des Hamburger SV überzieht? Fans, Experten, Verantwortliche und die Fußballer selbst haben sich in der jüngeren Vergangenheit vergeblich an Erklärungen versucht, wenn der HSV mal wieder an sich selbst gescheitert war. Eine abschließende Erkenntnis jedoch blieb aus, das Unerklärliche bleibt unerklärlich - und das Schauspiel vollzieht sich einfach weiter.
06.04.2021 09:03:40 [Neues Deutschland]
Nah an der Katastrophe
Borussia Dortmund ist nach der Niederlage gegen Frankfurt in der Champions League gefordert. Als Borussia Dortmunds Fußballer die edlen Auswärtsanzüge für die Champions League zum wohl letzten Mal für längere Zeit aus dem Schrank holten, hallte der Anpfiff vom Boss noch in ihren Ohren. »Ich habe die Mannschaft immer in Schutz genommen. Aber für das Auftreten im Spiel gegen Eintracht Frankfurt kann ich das nicht mehr machen. Das ist eine Willensfrage, und da hat mich die Mannschaft maßlos enttäuscht«, sagte Geschäftsführer Hans-Joachim Watzke vor der unlösbar erscheinenden Aufgabe bei Manchester City.
06.04.2021 09:05:10 [TAZ]
Vorschlag für Olympia in Berlin: '36 in der Wiedervorlage
Die Olympischen Spiele 2036 sollen in Berlin und Tel Aviv stattfinden, fordern deutsche Planer. Dabei wurde die israelische Seite gar nicht gefragt. Es sei „kein leichtes Thema“, und „ein schwieriges Datum“ sei es auch. Olympia ’36 soll wieder nach Berlin kommen, fordern in der Berliner Morgenpost Frank Kowalski und Richard Meng. Der eine war Organisationschef der Leichtathletik-EM, der andere ist Präsident der Deutschen Olympischen Gesellschaft Berlin.

Etwas genauer formuliert, wollen die beiden, dass 2036 nicht nur Berlin, sondern auch Tel Aviv die Olympischen Spiele austrägt – „zwei liberale und pulsierende Metropolen“.

06.04.2021 09:06:45 [Süddeutsche Zeitung]
FC Augsburg: Vergebliche Sehnsucht nach mehr
Der FCA ist nach dem 2:1 gegen Hoffenheim auch im zehnten Bundesligajahr dem Klassenerhalt nah. Darüber hinausgehende Ziele bleiben unrealistisch. Am Abend danach saß der Trainer im Fernsehstudio und sprach über den Unterschied zwischen realistischen und ambitionierten Zielen. Das realistische Ziel des FC Augsburg müsse stets der Klassenverbleib sein, sagte er. Und das ambitionierte sei es, "an den einstelligen Bereich ranzukratzen". Der Fußballlehrer, der das formulierte, war nicht der aktuelle Trainer des FCA, Heiko Herrlich. Sondern ein ehemaliger, der fünf Jahre für den Bundesligisten gearbeitet hatte, zunächst im Nachwuchs und später als Chefcoach der Profis.
06.04.2021 09:08:41 [Neues Deutschland]
Hertha BSC und FC Union: Stadtderby ohne Sieger
Der 1. FC Union Berlin kann mit der Punkteteilung besser leben als Hertha BSC. »Zu wenig«, schrie Sami Khedira nach einer Stunde Spielzeit auf den Platz. Der als Führungsspieler im Winter von Hertha BSC nach Berlin geholte Mittelfeldstratege wollte diese Rolle auch als Reservist ausfüllen, als er sich am Spielfeldrand aufwärmte. Der verzweifelte Ruf des Weltmeisters in der Alten Försterei half aber ebenso wenig wie dessen Einwechslung in der 79. Minute: Es blieb beim 1:1 im Stadtderby gegen den 1. FC Union. Robert Andrich hatte die Gastgeber mit einem sehenswerten Linksschuss nach zehn Minuten in Führung gebracht, Dodi Lukébakio 25 Minuten später per Foulelfmeter ausgeglichen.
06.04.2021 09:10:27 [Frankfurter Allgemeine Zeitung]
Reform der Champions League: Mehr Geld und noch mehr Langeweile
Es geht in erster Linie um Einnahmen und Macht. Mit der Reform der Champions League sollen die letzten Risiken des Wettbewerbs ausgeschlossen werden. Und was sagt der Fußballfan dazu? Ob sie den Namen nicht besser gleich mitreformiert hätten, der Ehrlichkeit wegen? Champions League – das hört sich ja irgendwie immer noch exklusiv an. Ist es aber nicht, aber das stört offenbar niemanden. Und es ist kein Problem, das der Fußball exklusiv hat. Der Sport expandiert und expandiert, da mögen Sportwissenschaftler und Trainer noch so sehr beklagen, dass die Belastungsgrenze für die Akteure längst überschritten ist, dass sich Verletzungen häufen werden.
06.04.2021 09:12:09 [Süddeutsche Zeitung]
FC Bayern: Das Vermächtnis der Kaiserzeit
Warum gewinnt der FC Bayern immer die wichtigen Spiele? Es hat mit einer klubinternen Erfolgskultur zu tun, die man als Gegner nicht erklären, aber fühlen kann. In der 52. Spielminute fällt das Tor für Leipzig - nicht. Der Spanier Dani Olmi steht vielversprechend im Münchner Strafraum, der Ball ist so freundlich, ihm abgefälscht vor die Füße zu fallen, Olmo sieht das Toreck einladend leuchten. Er hat sogar ein bisschen Zeit, er zielt genau, und es sieht sehr elegant aus, wie er den Ball dann knapp an Manuel Neuers Tor vorbeizirkelt.

In der 38. Spielminute fällt das Tor für den FC Bayern. Thomas Müller sprintet in die Tiefe, Joshua Kimmich sieht das und hält es offenbar für eine gute Idee.

06.04.2021 09:14:28 [Junge Welt]
Tennis: »Als ich so alt war wie du«
Im Machtvakuum: Beim Tennisturnier Miami Open gewinnt überraschend Hubert Hurkacz aus Polen. Am Ostersonntag gingen die sich über beinahe zwei Wochen dahingeschleppt habenden Miami Open mit dem Herrenfinale zu Ende. Es war ein Finale zweier Außenseiter mit einem Sensationssieger.

Der an 26 gesetzte 24jährige Pole Hubert Hurkacz, Nummer 38 der Weltrangliste, schlug eine der großen Nachwuchshoffnungen der ATP, den an 21 gesetzten 19jährigen Italiener Jannik Sinner mit 7:6, 6:4. Die Qualität des Matches war nicht übermäßig hoch, es war im wesentlichen von Sinners Fehlern geprägt.

07.04.2021 08:52:03 [Süddeutsche Zeitung]
Champions League: Die Bürde, Neymar zu sein
Der Brasilianer hat in dieser Saison erst zwölf Meisterschaftsspiele absolviert - gegen Lille fliegt er schon zum zweiten Mal vom Platz. Doch nicht nur fehlende Disziplin plagt Paris vor dem Duell mit dem FC Bayern. Neymar Junior ist nun auch schon 29 Jahre alt, man will es nicht für möglich halten. Er legt eine ansehnliche Karriere hin, wirklich transzendental aber ist sie nicht. Dafür steht er sich allzu oft selbst im Weg.

Am Wochenende, im 0:1 verlorenen Spitzenspiel der französischen Ligue 1 gegen Tabellenführer Lille, zeigte der expressive Profi in den Reihen von PSG mal wieder die ganze Palette seiner eher infantilen Reflexe.

07.04.2021 08:53:50 [TAZ]
Gleichstellung im Radsport: Wo bleibt die Tour der Frauen?
Die Bahnrad-Weltmeisterin Emma Hinze fordert eine „Tour de France“ für Frauen. Damit ist sie nicht allein. Weiblicher Radsport hat Tradition. Emma Hinze, dreimalige Bahnrad-Weltmeisterin, hat sich recht diplomatisch geäußert: „Es wäre cool, wenn auch Frauen so ein Rennen hätten, das über mehrere Tage geht und man auch im Fernsehen schauen kann“, hat sie gesagt. Was Hinze damit meinte: eine Tour de France für Frauen.

Falls Sie nicht regelmäßig Radsport verfolgen: Sie erschrecken zu Recht! Nein, es gibt tatsächlich keine weibliche Tour de France. Hat es nie gegeben. Es gab Rumpfformate unter verschiedenen Namen; das letzte ging 2009 zu Ende, litt unter zu wenig Geld und Sponsoren und durfte auch nicht „Tour“ heißen.

07.04.2021 08:55:22 [Süddeutsche Zeitung]
Jérôme Boateng beim FC Bayern: Nur noch zwei
Der Abschied von Jérôme Boateng markiert das Ende einer Ära. Es wird wieder ein bisschen nostalgisch werden im Sommer - aber immer nur zu den Bedingungen des Klubs. Im Finale der Champions League im Mai 2013 bekam Jérôme Boateng vom unbestechlichen Fachblatt Kicker die Note 2,5. Das war eine sehr respektable Zensur für einen Innenverteidiger, zumal sich Boateng mit einem Stürmer duellieren musste, der sich damals schon für den besten Fußballer der Welt hielt, obwohl er erst sieben Jahre später als solcher ausgezeichnet wurde.

Für alle, die es vergessen haben: Ja, Robert Lewandowski spielte mal für Borussia Dortmund.

07.04.2021 08:57:53 [Neues Deutschland]
FC Bayern München: Zu Hause gegen die Heimat
Kingsley Coman trifft mit den Bayern auf seinen Jugendverein Paris St. Germain. Die Meldung kam nicht überraschend. Allenfalls der Zeitpunkt der Nachricht von Jérôme Boatengs Abschied am Saisonende nach zehn Jahren beim FC Bayern verblüffte etwas, so kurz vor dem Hinspiel im Viertelfinale der Champions League gegen Paris Saint-Germain an diesem Mittwoch. Dass der Innenverteidiger im Sommer kurz vor seinem 33. Geburtstag gehen muss, wie das Fachmagazin »kicker« unter Verweis auf einen angeblichen Beschluss des Aufsichtsrats berichtete, hatte sich schon länger abgezeichnet. Offiziell bestätigt wurde diese Personalie zwar noch nicht, doch das ist wohl nur eine Frage der Zeit.
07.04.2021 09:00:55 [Süddeutsche Zeitung]
DFB-Pokal: Eine schöne Passage
Nach drei Siegen im Elfmeterschießen trifft der SSV Jahn Regensburg im Viertelfinale auf Werder Bremen. Bislang zwei Millionen Euro an Prämien helfen dem kleinen Zweitligisten, den pandemiebedingt geschrumpften Etat aufzubessern. Wenn der Regensburger Kapitän Benedikt Gimber seine Mannschaft an diesem Mittwochabend um kurz vor 18.30 Uhr aufs Fußballfeld im Jahnstadion führen wird, dann schreibt sie schon einmal Geschichte. Noch nie in seiner 114-jährigen Fußball-Historie spielte der SSV Jahn Regensburg ein DFB-Pokal-Viertelfinale.
07.04.2021 09:03:06 [Zeit Online]
Champions League: Gar nicht so schlecht für einen Bundesligafünften
Manchester City – Borussia Dortmund 2:1 (1:0). In Europa klappt, was in der Bundesliga misslingt: Trotz eines Gegentors in letzter Minute bei Manchester City darf sich der BVB Gedanken über das Halbfinale machen. Ausgeglichener als viele vorher vermutet hatten. Vor dem Duell mit dem weit enteilten Tabellenführer der Premier League haben selbst etliche BVB-Fans Schlimmes erwartet. Wer nicht einmal gegen den 1. FC Köln gewinnt, wird beim womöglich aktuell besten Klub der Welt nur trüb aus der Wäsche schauen, so die Annahme. Es kam anders. Manchester City spielte lange ungewöhnlich verzagt, die Dortmunder hingegen mit einer Selbstverständlichkeit und Qualität, die ihnen im Bundesligaalltag oft fehlt.
07.04.2021 09:04:40 [Junge Welt]
Olympia: Keine Lust auf Coronaspiele
Bilder der Hoffnung, symbolische Zeichen des Friedens und der Versöhnung – Thomas Bach hätte sie wohl allzu gerne gesehen: Die Olympischen Spiele in Tokio, eine Bühne für die geopolitisch bedeutsame Annäherung im jahrzehntelangen Korea-Konflikt. Dazu wird es, anders als bei den Winterspielen 2018 in Pyeongchang, nicht kommen. Der Wunsch des IOC-Präsidenten bleibt unerfüllt. Die Sommerspiele in Japan finden ohne eine Delegation aus Nordkorea statt.

Als erstes Land sagte die DVRK die Teilnahme in Tokio (23. Juli bis 8. August) ab. Als offizielle Begründung nannte das Sportministerium in Pjöngjang Sicherheitsbedenken aufgrund der Coronapandemie.

07.04.2021 12:48:49 [Schwatzgelb]
Wenn der Schiri pfeift
Trotz Niederlage hält sich der BVB die Chancen in der Champions League offen, doch eine Szene sorgte beim Hinspiel für Diskussionen. Der Frust bei den Anhängern des BVB sitzt nach den vergangenen Leistungen in der Bundesliga tief. Da kam der Gedanke nicht von ungefähr, dass man gegen eines der besten Teams Europas (bzw. der Welt) gnadenlos untergehen würde. Allerdings wäre es auch nicht das erste Mal, dass die Borussia national vor sich hindümpelt, um international die Kohlen aus dem Feuer zu holen. Und so zeigte die Mannschaft von Edin Terzic eine durchaus ansprechende Leistung gegen Manchester City und weckte damit die Hoffnungen bei Schwarz-Gelb, dass in diesem Duell tatsächlich was gehen könnte.
10.04.2021 08:27:07 [TAZ]
FC Bayern München und Schnee: Schönwetter-Rekordmeister
Die Erkenntnis dieser Woche ist: Der FC Bayern München kann kein Schnee. Holstein Kiel hat im DFB-Pokal mutig und effizient und am Ende mit etwas Glück davon profitieren können, damals im dichten Schneetreiben an der Ostsee; Arminia Bielefeld hat im Februar immerhin einen Punkt aus München mitnehmen dürfen; und die Superstars aus Paris ließen sich an diesem Mittwoch die Gelegenheit nicht entgehen, dass die Bayern-Abwehr inklusive Welttorhüter im Schnee gerne mal zur Rutschpartie neigt und vorne der verletzte Robert Lewandowski nur zweit-, wenn nicht gar drittklassig ersetzt werden kann.
10.04.2021 08:28:54 [Süddeutsche Zeitung]
Hansi Flick: Ein wohlgewählter Monolog
Im Dauerkonflikt mit Sportvorstand Salihamidzic äußert sich Bayern-Trainer Hansi Flick noch einmal wortreich und spricht über Störfeuer, Loyalität, die Qualität des Kaders und warum er sich eine "Teilschuld" gibt. Hansi Flick konnte am Freitag ein Jubiläum feiern. Zum 70. Mal seit Beginn der Corona-Pandemie, das sagte auf dem Podium neben ihm der Pressesprecher Dieter Nickles, hielt der Trainer des FC Bayern eine Pressekonferenz vor den Bildschirmen anstatt vor leibhaftigen Reportern an der Säbener Straße; diesmal anlässlich des Bundesligaspiels gegen Union Berlin an diesem Samstag.
10.04.2021 08:30:42 [Neues Deutschland]
Die Freizeit endet im Baseballstadion
Der Sport in den USA wollte stets politikfrei sein. Das kann er sich nun nicht mehr leisten. Denver ist das neue Atlanta. Die Major League Baseball (MLB) hat vor gut einer Woche entschieden, ihr Allstar-Spiel am 13. Juli nicht mehr in der Südstaatenmetropole Atlanta auszutragen. Am Dienstag folgte die Ankündigung, dass die beste Baseballliga der Welt ihre Stars lieber am Rande der Rocky Mountains Homeruns schlagen lässt. Das hatte nichts damit zu tun, dass ein Baseball in der »Mile High City« Denver weiter fliegt. Nein, die Entscheidung war politisch, und das ist für die MLB etwas ganz Neues.
10.04.2021 08:32:47 [TAZ]
„Das ist frustrierend ohne Ende“
Mit Quarantäne kennt sich Markus Kauczinski aus. Der Trainer des Fußball-Drittligisten Dynamo Dresden über Trainingsdefizite und seine eigene Corona-Infektion. TAZ: Herr Kauczinski, was war Ihr erster Gedanke, als Sie hörten, dass Ihr Ex-Verein KSC und der SV Sandhausen 14 Tage in Quarantäne müssen?

Markus Kauczinski: Ich dachte: Gott sei Dank hat der KSC jetzt schon 42 Punkte. Für den KSC und Sandhausen wird es jetzt heftig.

Sie befürchten, dass bei denen nach den zwei Wochen Quarantäne nicht mehr viele Punkte dazukommen?

Das weiß ich nicht. Aber sie und Sandhausen werden einen Preis zahlen, so wie wir ihn auch in der vergangenen Saison gezahlt haben.

10.04.2021 08:34:07 [Zeit Online]
München unter den Wackelkandidaten für die EM 2020
Der Stadt München droht das Aus als EM-Gastgeber in diesem Sommer. Die bayerische Landeshauptstadt, in der die Gruppenspiele der deutschen Nationalmannschaft stattfinden sollen, gehört zu den vier Standorten, die bis zum 19. April ihre Pläne für das Turnier nachreichen müssen, wie die Europäische Fußball-Union (Uefa) mitteilte. Dann werde endgültig über die Ausrichtung der Partien an diesen Spielorten entschieden. Konkret geht es um die von der Uefa geforderte Zulassung von Zuschauern. Acht EM-Städte habe diese bereits zugesichert – nicht so München.
10.04.2021 08:35:38 [Süddeutsche Zeitung]
1. FC Köln: Doppeltes Endspiel
Der FC, ein Klub mit großer Stürmertradition, sehnt sich im Duell um den Klassenverbleib gegen Mainz nach Toren seiner Angreifer. Anthony Modeste ist zwar nicht mehr in der Stadt, aber die Zeilen, die in einer endlosen Ode seine Taten besingen, werden für immer dem Kölner Liedgut angehören.

"Wer feiert täglich Schützenfest?" "Wer trinkt gern Kölsch vorm Dopingtest?" "Wer putzt sing Zäng mit Dr. Best?" "Wer trinkt den O-Saft frisch gepresst?" All diese rhetorischen Fragen und 1000 weitere vom Volksmund zusammengetragene Weisen bahnen den Weg zu stets demselben Reim namens Anthony Modeste und schaffen damit das endlose Lied für euphorische Chorgesänge in der überfüllten Straßenbahn.

10.04.2021 08:37:10 [Junge Welt]
Sporthistorie: »Ohne Olympische Spiele könnten viele Sportarten nicht existieren«
Gespräch mit Volker Kluge. 125 Jahre Olympia der Neuzeit: Über Coubertins Trick, Fans auf Bergen und »Vaterlandsverräter«. Vom 6. bis 15. April 1896 fanden die ersten Olympischen Spiele der Neuzeit statt und schlugen allein mit ihrem Austragungsort Athen die historische Brücke zu den antiken Spielen, die in Olympia erstmals im Jahr 776 vor unserer Zeitrechnung ausgetragen und dort bis ins Jahr 393 fortgeführt worden sein sollen. Wie kam Baron Pierre de Coubertin auf die Idee, nach über 1.500 Jahren Pause die Olympischen Spiele der Antike wiederzubeleben?
10.04.2021 08:39:41 [Zeit Online]
Hula-Hoop: Heute schon gehullert?
Jede Umdrehung zählt: Hula-Hoop ist wieder mächtig angesagt. Unser Autor versucht mit 40 Jahren in die Trendsportart einzusteigen. Trotz steifer Hüfte. Irgendwann im Jahr 1957: Die gebürtige Australierin Joan Anderson kommt nach einem Familienbesuch zurück nach Los Angeles und berichtet ihrem Mann von einem Phänomen in ihrer alten Heimat: ein Reifen aus Bambus, den man um die Hüfte schwinge. "Warum hast du keinen mitgebracht?", fragt er. Andersons Mutter schickt daraufhin einen in die USA. Bei einer Dinner Party kommen die Andersons mit einem Freund auf den Namen: "Hula-Hoop". Sie stellen den Reifen Arthur Melin vor, Mitgründer der Spielzeugfirma Wham-O. Man einigt sich via Handschlag auf eine Gewinnbeteiligung, sollte der Reifen ein Erfolg werden.
10.04.2021 10:48:17 [Schwatzgelb]
Zurück ins Tal?
Nach dem erstaunlichen Auftritt am Dienstag-Abend gegen Machester City, geht es nun wieder in das grauere Bundesliga Tages- oder wie man so schön sagt Brot- und Buttergeschäft. Gegen den VfB aus Stuttgart. Der Aufsteiger hat sich, trotz all der Querelen rund um die Präsidentenwahl und anderem, erstaunlich entwickelt und ist nun, man kann es nicht oft genug sagen, sogar Aspirant auf einen Platz im internationalen Wettbewerb. Und das trotzdem man das Geld aus der Ausgliederung (auch darüber könnte man Seiten füllen) so schnell verbraten hat, wie man ansonsten nur Eis in der Sonne schmelzen sieht.
 Ansichtssache, Meinung, Kommentare, Diskussion, Debatte, Hintergrund, Verschiedenes (108)
01.04.2021 09:42:01 [Polit Platsch Quatsch]
Grosse Studie zu Corona-Massnahmen: Privat vor Katastrophe
Je länger die Ratlosigkeit dauert, welche "Maßnahmen" nun eigentlich gegen Corona helfen, desto mehr rückt das Privatleben der Menschen ins Visier. Dort, so heißt es, geschähen die meisten Ansteckungen, nicht im Bus und Bahn, nicht in den Schulen, den Werkhallen, Kinos, Kneipen oder Büros. Soundsoviel Prozent müssten dem Privatbereich zugerechnet werden, einer bedrohlichen black box, in die Vater Staat leider immer noch gar nicht so genau hineinschauen kann. Was tun die Leute da? Wie stecken sie sich immer noch an?

Beim gemeinsamen Ausweichsaufen im Wohnzimmer, beim illegalen Familienbesuchen und nicht-eindämmungsverordnungsgemäßen Skatrunden.

01.04.2021 09:50:15 [Der Freitag]
Ey, runter da von meinem Zeh!
Ja, die gegenwärtigen Debatten werden hitzig geführt. Aber es ist ein Unterschied, ob man beleidigt wird oder seinen Standpunkt mit dem Leben bezahlt. Wenn jemand mir hart auf den Fuß tritt, schreie ich. Ich sage nicht: Oh, entschuldigen Sie bitte, Sie zerquetschen da gerade meinen kleinen Zeh, wären Sie so nett, mir den Platz für alle meine Zehen auf diesem Boden zurückzugeben? Sondern ich schreie: Ey, runter da!!! Gerade wird sehr vielen Leuten sehr doll auf die Füße getreten. Denn es geht um alles. Verhandelt wird mit dem Ende des fossil betriebenen Industriekapitalismus nicht nur eine Energiequelle, sondern gleich ein ganzes Produktionsregime, und mit ihm die Organisierung der Gesellschaft auf allen Ebenen.
01.04.2021 10:07:09 [Telepolis]
Abgedrängt an die Ränder
Was passiert, wenn man sich mit der falschen "Haltung" für Deeskalation im Verhältnis zu Russland einsetzt. Wie geht es einem Menschen, dessen Lebensthema die Verständigung zwischen Ost und West ist, in der heutigen Zeit, am Rande eines neuen Kalten Krieges? Wie kann er sein Anliegen der Deeskalation in der vielfältigen deutschen Medienlandschaft kommunizieren, wenn er auch noch die Position vertritt, dass Russland nicht immer an allem schuld ist? Ein Lehrstück.

Ich bin kein Kriegskind, aber ein Kind des Kalten Krieges. Und das Thema "Ost-West" ist mein Lebensthema.

01.04.2021 11:23:28 [Konjunktion]
USA: Die mediale
Während sich Deutschland nach dem offiziellen Narrativ der Politik und der Hochleistungspresse aktuell in der 3. Welle dieser Plandemie befindet, Frankreich in den knallharten Lockdown übergeht und in Belgien und Österreich erste Gerichte die Maßnahmen kippen bzw. als verfassungswidrig befinden, befinden sich die USA laut der dort ausgegebenen Propaganda bereits in den 4. Welle. Wobei sich nicht nur dort die meisten Menschen die Frage stellen dürften: wo war die erste, zweite oder dritte?
01.04.2021 13:20:14 [Polit Platsch Quatsch]
Klimawohlstand: Ein Fantasiewort als Versprechen
Fußballspielen können sie nun auch nicht mehr. Nach der Niederlage der deutschen Fußballnationalmannschaft gegen das seit kurzem Nordmazedonien genannte frühere Mazedonien, wachsen die Zweifel in Deutschland, ob irgendwas überhapup noch einmal was wird. Ja, viele sind einverstanden, dass Deutschland als europäischer Kernstaat ein Zeichen setzt und seine Stromversorgung nach Frankreich, Tschechien und Polen auslagert. Ja, viele gehen auch noch mit, dass die frühere Nation für die Schulden der EU bürgt, um die Gemeinschaft zusammenzuhalten. Geld ist genug da. Doch dass die früher so beliebten Nationalkicker sich gegen ein Land blamieren, das einer Umfrage zufolge 87 Prozent der Deutschen nicht auf der Landkarte zeigen könnten, geht denn doch zu weit.
01.04.2021 13:29:20 [RT DE]
Vier Jahre Albtraum ohne neuen Krieg endlich zu Ende
Ein Beitrag zum 1. April: Für die eingefleischten Atlantiker ist der lange Albtraum von Frieden und trägem Wohlstand der Massen endlich vorbei. Das war die frohe Botschaft, die vom Frühjahrstreffen der NATO-Außenministerkonferenz am Dienstag und Mittwoch vergangener Woche in Brüssel ausging. Zu diesem positiven Ergebnis hatte vor allem der neue US-Minister Antony Blinken entscheidend beigetragen. Denn Blinken ist nicht nur Joe Bidens langjähriger Vertrauter und Berater, sondern er hat sich auch in seinen 25 Jahren im Auswärtigen Dienst der USA als herausragender US-Diplomat qualifiziert, der sich mit großem persönlichem Engagement stets für den humanistischen US-Werte-Kanon eingesetzt hat.
01.04.2021 15:08:18 [Ceiberweiber]
Ist „Zackzack“ ein Schmuddelblatt?
Noch während der erfolglosen Kandidatur bei der Wahl 2019 gründete Peter Pilz mit eigentlich für politische Bildung vorgesehenen Geldern das Online-Medium „Zackzack“. In den letzten Wochen wird deutlich, dass dieses über eine ganz spezielle Beziehung zur Justiz verfügt, besonders zur Korruptionsstaatsanwaltschaft. Aktuell verwirrt es, indem es behauptet, die Redaktion des „Kurier“ habe Anzeige gegen Bundeskanzler Sebastian Kurz erstattet wegen der Ablöse von Chefredakteur Helmut Brandstätter durch Chefredakteurin Martina Salomon (dies greift die SPÖ gerne auf). Dass Pilz und seine Mannen stets bereit sind, Frauen jede Kompetenz abzusprechen, sieht man auch an ihrem Umgang mit „Exxpress“-Gründerin Eva Schütz.
01.04.2021 17:30:25 [Conservo]
31 Gründe, warum ich mich nicht impfen lassen werde
Vorbemerkung: Im Internet stieß ich auf Rabbi Weissmans wunderbare, erhebende Liste mit 31 Gründen, warum er sich nicht impfen lassen wird. Mit seiner Erlaubnis habe ich die Liste übersetzt und freue mich wie er über die weite Verbreitung dieser Liste, um so Menschen Mut und einen klaren Blick dafür zu geben, worum es geht und was wirklich zählt. 1. Hier geht es nicht um einen Impfstoff. Impfstoffe verleihen definitionsgemäß Immunität, doch diese Behandlung verleiht keine Immunität gegen eine wie auch immer geartete Erkrankung. Im besten Fall verringert sie nach einer Ansteckung lediglich die Wahrscheinlichkeit einer schweren Viruserkrankung. Folglich handelt es sich um eine medizinische Behandlung und nicht um eine Impfung. Ich möchte keine medizinische Behandlung für eine Krankheit, die ich nicht habe.


01.04.2021 18:46:16 [Neuland Rebellen]
Corona-Politik
Zu Risiken und Nebenwirkungen machen Sie sich bitte ernste Gedanken. Im Grunde sind die Nebenwirkungen der Corona-Politik allgemein bekannt. Ignoriert werden sie aber dennoch. Wir möchten auf die fatalen Entwicklungen hinweisen, die die Maßnahmen gegen Corona mit sich bringen.

Das nun folgende Video entstand in einer Phase der Ermüdung meinerseits. Vermutlich wirkt es daher nicht so kämpferisch oder provokant wie andere Videos der neulandrebellen. Das mag den einen besser, den anderen weniger gut gefallen.

Wir wollen aufmerksam machen auf die Entwicklungen, die jeder kennt und die trotzdem bei der Frage nach der entsprechenden Corona-Politik keine Rolle spielen.

01.04.2021 18:54:23 [Dushan Wegner]
Gib Pfötchen, Bürger!
Es ist nicht zwingend ein »Fehler« im System, dass deutsche Coronamaßnahmen widersprüchlich und unlogisch wirken. Indem man Menschen zwingt, unlogischen Befehlen zu gehorchen, dressiert man sie zu blindem Gehorsam. Was ist heute eigentlich der aktuelle Stand, ob, warum und an wen der Impfstoff von AstraZeneca verimpft werden darf? Aus Deutschland werden Fälle von Hirnvenenthrombosen nach einer Impfung bekannt – und also soll man das Zeug nur an Menschen über 60 Jahren impfen. Weil es bei denen nicht gefährlich ist? Weil sie sowieso »egal« sind? Fakt ist: Was eben noch als »Verschwörungstheorie« beschimpft wurde, das ist plötzlich ganz selbstverständliche Realität – Impfungen können töten, und die Gefahr ist real.
02.04.2021 07:18:53 [Vera Lengsfeld]
Die grüne Macht – Wie die Ökopartei das Land verändern will
Es tut tatsächlich gut, ab und zu etwas von einem Autor zu lesen, der ganz anderer Meinung ist, als man selbst. So ging es mir mit dem Buch von Ulrich Schulte, Leiter des Parlamentsbüros der taz, als solcher bestens vernetzt im Parlamentsbetrieb. Schulte hat den Aufstieg von Annalena Baerbock und Robert Habeck nach eigener Einschätzung „eng begleitet“ und beschreibt, in seinem Buch „Die grüne Macht“ wie es den beiden gelang, die Grünen in eine befriedete, staatstragende Regierungspartei im Wartestand zu verwandeln. Auch wenn die beiden Co-Chefs nicht bei Null beginnen mussten, denn frühere Spitzenpolitiker wie Joschka Fischer und auf seine Weise Jürgen Trittin haben Beträchtliches geleistet, die Grünen als Juniorpartner in rot-grünen Regierungen in den Ländern, in der Ära Schröder auch im Bund, zu profilieren.
02.04.2021 07:26:20 [Orbis]
Wann kommen die Klima-Lockdowns?
„Eine Impfung gegen CO2 wird es allerdings niemals geben. Somit benötigen wir Maßnahmen zur Bewältigung des Klimawandels, die analog zu den Einschränkungen der persönlichen Freiheit in der Pandemie-Bekämpfung sind.“

Ja Sie haben richtig gelesen! Diesen Vorschlag hat kein geringerer als der SPD-„Gesundheitsexperte“ Karl Lauterbach unterbreitet, um die vom Weltwirtschaftsforum (WEF) und den Vereinten Nationen vorgegebene radikale Klimapolitik zu promoten.

Und falls Sie der Auffassung sein sollten, dass diese Zweckentfremdung der Lockdown-Maßnahmen Zukunftsmusik sind, sind Sie auf dem Holzweg.

02.04.2021 09:22:45 [QPress]
Alternativlos … Robert Habeck als Kanzlerin
Damit hat bislang wohl noch niemand gerechnet. Robert Habeck als neue Bundeskanzlerin der Bananenrepublik Deutschland. Offenbar haben die Menschen ihm ich richtig zugehört und Anne Will versäumte es bis zum brutalen Ende durchzufragen. Eigentlich hat aber seinen Trick völlig offen und schonungslos bereits angedeutet. Er muss lediglich als Frau für die Kanzlerposition antreten und schon ist die Annalena völlig “gebaerbockt”. Die Statuten der Grünen geben das her.
02.04.2021 09:48:33 [Klaus Peter Krause]
Raubgut
Sie wollen moralisch sein und sind es nicht. Sie sprechen von Recht und Gerechtigkeit und handeln nicht danach. Sie verwickeln sich damit in Widersprüche, aber das stört sie nicht. Politiker sind so, und entsprechend halbseiden ist dann auch ihre Politik. Zum Beispiel bei der Rückgabe von Eigentum, das in den Besitz des deutschen Staates geraten ist, ihm rechtmäßig aber nicht gehört und nicht zusteht. Derzeit geht es gerade um Kulturgut aus dem Königreich Benin, das bis zum Jahr 1897 unabhängig war und im Südwesten des heutigen Nigerias liegt. Dieses Kulturgut sind die rund elfhundert „Benin-Bronzen“, die in deutschen Museen gelandet sind und als sehr wertvoll gelten. Sollen sie nach Afrika zurückgegeben werden? Müssen sie es?
02.04.2021 09:55:18 [KenFM]
Die AstraZeneca-Affäre: Was steckt dahinter?
Die Berichterstattung der Mainstream-Medien und die Vorgänge im realen Leben haben in unserer Zeit immer weniger miteinander zu tun. Es empfiehlt sich daher, sorgfältig zwischen beiden zu unterscheiden. So auch in der AstraZeneca-Affäre der vergangenen Wochen.

Die offizielle Version des Geschehens lautet:

Der Impfstoff der Firma AstraZeneca hat bei diversen Menschen Nebenwirkungen hervorgerufen, die in einzelnen Fällen sogar zum Tode geführt haben. Aus Sorge um die Gesundheit der Bevölkerung wurde die Impfung mit diesem Impfstoff daher am Montag, den 15. März, ausgesetzt.


02.04.2021 09:58:08 [Deliberation Daily]
Ist das noch Wissenschaft oder längst Ideologie?
Die Naturwissenschaften gelten gemeinhin als Königsdisziplin. Ihr exzellenter Ruf als rein Logik basierte Fachbereiche erhebt sie im Volksempfinden über sämtliche Konkurrenzfächer, denen nicht selten wegen ihrer ungenauen Ergebnisse die Wissenschaftlichkeit abgesprochen wird. Dabei unterscheiden sich die Fachrichtungen wie die Sozialwissenschaften allein durch das Objekt der Untersuchung. Ökonomen und Soziologen schauen nicht auf Bälle, die zu Boden fallen und berechnen deren Geschwindigkeit, sondern betrachten das Verhalten von Menschen.
02.04.2021 10:00:16 [Peds Ansichten]
Ein Jahr Corona und die Realität des Undenkbaren
Wer geradezu manisch auf „Verschwörungsideologen“ zeigt, hat etwas zu verbergen! So man sich vollumfänglich der Wahrheit verpflichtet fühlt, gibt es keinen Grund, sich an den Thesen und Hypothesen anderer abzuarbeiten. Eher nutzt man diese, um die eigenen wissenschaftlichen Erkenntnisse einer gründlichen Prüfung zu unterziehen. Dabei denkt man komplex und bezieht möglichst viele unterschiedliche Faktoren und Sichten in die zu verfassende Theorie ein. Die unfassbare Einseitigkeit, mit der die seit einem Jahr verhängten „Corona-Maßnahmen“ begründet werden, ist davon das genaue Gegenteil und sollte immer mehr Menschen höchstgradig misstrauisch werden lassen.
02.04.2021 10:03:23 [Klaus Peter Krause]
Die CO2-Steuer als Torheit und Verblendung
Autofahren und Heizen sind in Deutschland seit Jahresbeginn 2021 teurer geworden, weil Benzin, Diesel, Heizöl und Erdgas teurer geworden sind. Dies nicht deswegen, weil sie sich verknappt haben, sondern weil sie der Bundestag mit seiner Klimaschutz- und Energiewendepolitik künstlich verteuert hat. Er belastet das Kohlendioxid (CO2), das beim Verbrennen dieser Energieträger wieder frei wird, mit einer Steuer von 25 Euro je Tonne CO2-Emission. Bis 2025 soll diese Steuer auf 55 Euro steigen. Mit ihr belastet sind auch die stromerzeugenden Kohle- und Gaskraftwerke. Es ist eine zusätzliche Belastung, denn um Kohle und Gas verbrennen und damit CO2­ „ausstoßen“ zu dürfen, müssen sie bereits Erlaubnisscheine kaufen, CO2-Zertifikate genannt.
02.04.2021 12:21:19 [Der Freitag]
Wohlfahrt: Sorge, Staat, sorge!
Deutschland taumelt in die dritte Welle, manche sprechen von Staatsversagen. Aber die Misere reicht tiefer: 30 Jahre Neoliberalismus verhindern vorausschauende Politik. Stellen wir uns kurz einmal vor, wie die Pandemie verlaufen wäre, wenn der Staat vor einem Jahr vorsorglich gehandelt hätte. Man hat also aus der ersten Welle gelernt, weil man verstanden hat, worauf es ankommt: Die Kliniken wurden besser mit Material und vor allem mit Personal ausgestattet, die Produktion schnell auf eigene Masken und Filter umgestellt und alle verfügbaren Mittel der Forschung in die breite Impfstoffproduktion gesteckt.
02.04.2021 14:40:11 [Zettels Raum]
Statistik, Märchen und andere Geschichten
Es ist schon ein Kreuz mit dem Impfstoff in Deutschland. Da Ursel Fond-of-Lying die Bestellung bei Pfizer, wie erwartet, in den Sand gesetzt hatte, musste schnell ein neuer Kandidat her und das war AZD 1222 (vulgo der "Astra-Zeneca-Impfstoff"). Dieser bot zwei ganz entscheidende Vorteile: Erstens, er war billig (er kostet nur ein Viertel der Pfizer Variante) und außerdem war Astra-Zeneca im Unterschied zu Pfizer noch nicht völlig ausgebucht und wollte bis Ende 2021 knappe 200 Millionen Dosen an die EU liefern.

So weit, so gut. Was dann aber nicht so gut war, war dann die Verträglichkeit. Wie so oft, wenn etwas vor allem schnell gehen muss, war das Ergebnis eben nicht ganz optimal.

02.04.2021 14:49:38 [M 7]
Der Dunkelheit folgt das Licht
Wer früh aufsteht, so besagt ein jüdisches Sprichwort, dem gehört die Welt. Für einen Augenblick jedenfalls kann man den Eindruck gewinnen. Heute morgen, als die Sonne aufging, war so ein Moment. Goldenes Licht, transportiert von einem eisigen, aus Osten kommenden Wind. Alles leuchtete, der Fluß lag blau und stählern im satten Grün der Wiesen und die wenigen Menschen, die zu sehen waren, schienen das alles gleichermaßen zu genießen. Alles wirkte, als lebten wir in einer unbeschwerten Zeit, in der das pure, schlichte und bescheidene Dasein kein Accessoire mehr brauchte, um glücklich zu machen. Das, was in diesen Zeilen zum Ausdruck kommt, ist das Abfallen einer ungeheuren Last, die das menschliche Empfinden immer mehr auf den Boden drückt.
03.04.2021 06:37:24 [Thomas Schmid]
Sind Experten die besseren Politiker?
Vor einem halben Jahrzehnt stürzte die Flüchtlingsfrage Deutschland in eine folgenreiche Krise. Den Migrationsbefürwortern standen jene schroff gegenüber, die nationale Souveränität sowie Grenzschließungen einforderten und der Bundeskanzlerin Rundumversagen vorwarfen. Letztere, unter ihnen zahlreiche Ex-Linke, glaubten aber bald, Verbündete auf der politischen Bühne gefunden zu haben: Politiker, die für den betont starken Migrationsabwehr-Staat eintraten. Etwa der damals noch sehr abwehrbereite Markus Söder. Der Star unter ihnen wurde aber schnell Österreichs junger Bundeskanzler Sebastian Kurz.
03.04.2021 08:59:25 [Tichys Einblick]
Alpha-Frau und Beta-Männchen. Ist Schäuble Laschets Vorbild?
Wie kann ein Mann von doch einigem Verstand glauben, Deutschland sei im vergangenen Jahr „über sich hinaus gewachsen“? Oder: „Deutschland erlebt ungeahnte Beweglichkeit“. Häää? Deutschland geht an seiner Unbeweglichkeit gerade ein. Vielleicht ist dies das Widerwärtigste: Die Moralposaunisten täuschen Sorge um den Schutz der Bevölkerung vor. In Wahrheit benutzen Söder & Co. die Pandemie für ihren Machtkampf. Es geht noch nicht einmal um Wahlkampf. Sonst würde CSU-Söder nicht mit dem Grünen Kretschmann in die Schlacht gegen CDU-Laschet ziehen. Erneut schaut die CDU nur fassungslos zu. Und lässt es geschehen. Söder ist dabei, Laschet aus dem Ring zu boxen.
03.04.2021 09:00:55 [Polit Platsch Quatsch]
Corona: Wettlauf um die höchste Betroffenheit
Die Frauen. Die Jugend. Die Armen. Der Mittelstand. Die Künstler. Und die Künstlerinnen. Die Älteren. Die Jüngeren. Die Schüler. Die Schülerinnen. Transmenschen? Die Gastronomen. Oder gar die Politik? Nachtsitzungen, größte Mühe, kleinster Effekt. Bröckelnde Umfragewerte, zerstörtes Vertrauen. Oder der Fußball, der einfach weitermacht, als wäre nichts passiert, fast auf Dienstreise in einen neuen hot spot mit neuen Mutationen? Auch nach einem Jahr Pandemie ist der vielleicht bedeutsamste Wettlauf der Seuchenzeit nicht entschieden. Wer ist das größte Opfer? Wen hat es am schlimmsten getroffen?
03.04.2021 11:28:56 [Tichys Einblick]
Hans-Georg Maaßen geht in die Politik – konsequent und klar durchdacht
Hans-Georg Maaßen ist schon im Äußeren der klassische Typus eines deutschen Spitzenbeamten. Stets gekleidet im grauen Anzug. Nicht allzu auffällige Krawatte, klare und seinem Gegenüber ins Gesicht blickende Augen – interessiert und dennoch kühl und distanziert. Die Aussprache ist deutlich, manchmal etwas zu leise, dafür aber selbst bei alltäglichen Sachverhalten im Satzbau logisch und mindestens intellektuell anmutend. Gesicht und Haltung wirken diszipliniert und unaufgeregt. Niemand käme auch nur auf die Idee, diesen Mann bestechen zu können. Hans-Georg Maaßen ist einer von denen, die ihren Amtseid noch ernst nehmen, sich dem Gemeinwesen, dem sie dienen, bis tief ins Innerste verpflichtet fühlen.
03.04.2021 17:05:09 [Antikrieg]
Die Banalität des Bösen bei Blinken
Das 1963 erschienene Buch "Eichmann in Jerusalem: Ein Bericht über die Banalität des Bösen, verfasst von der jüdischen Philosophin Hannah Arendt, machte die Welt mit dem vielleicht erschreckendsten Aspekt des nationalsozialistischen Massenmordes an so vielen Juden, Christen, anderen religiösen Minderheiten - und so vielen anderen - durch die Hände der nationalsozialistischen Mordmaschine Hitlers bekannt: der Tatsache, dass das Grauen des Massenmordes in kolossalem Ausmaß nicht mit der feurigen Dramatik geifernder Monster, sondern mit der kalten Präzision des unreflektierten Bürokraten durchgeführt werden konnte. Das Rädchen im Getriebe. Die Eichmanns dieser Welt, deren Verteidigung achselzuckend lautete: "Ich habe nur meinen Job gemacht."
03.04.2021 17:08:48 [Tichys Einblick]
Corona und EU-Länderfinanzausgleich
Auch Krisen haben ihre guten Seiten, jedenfalls für Politiker. Die Corona-Epidemie trägt ohne Zweifel Züge einer schweren Krise. Aber, wie gesagt, alles hat sein Gutes. Corona hat der deutschen Regierung die Chance gegeben, im Dämmerlicht der allgemeinen Verwirrung und Angst endlich das durchzusetzen, was man im Geheimen wohl schon immer beabsichtigt hatte – jedenfalls gilt das für die SPD, aber wohl auch für große Teile der CDU: Aus der Währungsunion des EURO ist durch den sogenannten „Wiederaufbau-Fonds“ der EU eine echte Fiskalunion geworden.


03.04.2021 17:30:00 [Anderwelt Online]
Russisches Roulette mit der Corona-Impfung
Es war klar: Man stirbt an oder mit Corona, aber keinesfalls an oder mit der Impfung. Nun können doch eine Anzahl von Impftoten nicht mehr verleugnet werden. Doch wie akut ist die Gefahr eines Impfschadens tatsächlich?

Wie üblich werden die Zahlen über Opfer der Corona-Impfung so dargestellt, dass ein einfacher Risikobezug erst durch Nachrechnen erkannt werden kann. Nach wie vor wird nur bei AstraZeneca über Schäden berichtet und bei Moderna gibt es die nicht. Das ist die erste glatte Lüge. Gerade bei Moderna werden Impfschäden bereits zu Hunderten beobachtet. Natürlich wird nur von unabhängigen Medien darüber Buch geführt.

03.04.2021 18:55:08 [Telepolis]
Campact für harten Lockdown
Die Forderungen sind bemerkenswert für eine Organisation, die einmal aus der sozialen Bewegung entstanden ist. Ein Kommentar: "Die Corona-Pandemie gerät außer Kontrolle. Fordern Sie einen harten Lockdown, um die dritte Welle zu brechen." In diesem alarmistischen Ton ist ein Eil-Appell des Kampagnennetzwerks Campact verfasst.

"Die halbherzige Politik der letzten Monate hat versagt und die dritte Welle erst ermöglicht. Jetzt braucht es einen klaren Einschnitt, damit wir das Virus unter Kontrolle bekommen."

Neben verbindlichen Homeoffice-Regelungen und Testpflicht in den Betrieben werden eher unverbindlich "schnelle Hilfen" für die vom Lockdown-Betroffenen gefordert.

04.04.2021 06:54:59 [Heise]
Irgendwie geht's weiter
Wie immer möchte die Wochenschau von Hal Faber den Blick für die Details schärfen. Etwas verwunderlich ist es schon, dass noch niemand Frank Underwoods "America Works Programme" mit Joe Bidens "American Jobs Plan" assoziiert hat. Aber solche Namensassoziationen sagen ja nichts über den Inhalt und die Politiker aus. Halt, Moment, Francis Underwood war gar kein Politiker, sondern nur eine von einem inzwischen geächteten Schaupspieler dargestellte Figur? So kann's gehen, wenn die Monster das Bewusstsein prägen und Netflix die Geschichtsschreibung übernimmt. Was die Briten besonders bedauern.. Medienkompetenz, my ass. Lustig ist die Biden/Underwood-Assoziation trotzdem.
04.04.2021 09:31:35 [Polit Platsch Quatsch]
Impfschlacht mit England: Mörderische Mutante
Es ist ein Todesdrama, das auf offener Bühne spielt. Im Mittelpunkt: Der Brexit, der britische Impfstoffnationalismus, Angela Merkel, Ursula von der Leyen und das deutsche Impfstoffversagen, aber auch Horst Seehofer, der Altinternationale des ehemaligen konservativen Flügels der Union, schiebt sich seitlich ins Bild. Er lasse sich nicht mit dem Vakzin aus dem perfiden Albion impfen, so der Bundesinnenminister. Und dazu zwingen werde er sich auch nicht lassen. Die Rückeroberung der europäischen Souveränität, ein Akt der Selbstbehauptung. Über Monate hatte der alte Feind von der Insel die zurückgebliebene Wertegemeinschaft verhöhnt.
04.04.2021 11:02:02 [Meine Meinung Meine Seite]
Es geht auch anders
In vielen EU- Staaten werden Lockdowns verhängt oder auch Teillockdowns, weil sie nur einzelne Bundesländer betreffen; so wie in Österreich. Dass diese Maßnahme dann „Osterruhe“ genannt wird, ist zumindest zynisch. Und obendrauf gibt es die Drohung vor weiteren Teillockdowns, wenn sich die Leute nicht so verhalten, wie die Regierung es erwartet und wegen des Fehlverhaltens der Leute die Zahlen steigen. Und zusätzlich liest man laufend, dass Corona- Partys „gesprengt“ wurden und dass es insgesamt sehr viele Anzeigen gibt wegen Verstößen gegen die Corona- Regeln.
04.04.2021 13:03:46 [Rationalgalerie]
Wollt Ihr den totalen Drosten?
Nie würde Christian Drosten brüllen, nie würden seine sorgfältig, einzeln gelegten Locken verrutschen, nie käme ihm ein Kraftausdruck über die Lippen. Der Herr über das Virus bügelt seine Unterhosen: Aufgesetzte Seriosität ist sein Markenzeichen. Mit diesem Marketingkonzept und der massiven Unterstützung der Seuchen-Medien ist er zum Corona-Prophet geworden und darf jetzt als erster den nächsten Lockdown fordern: "Wir werden um einen ernsthaften Lockdown nicht ­herumkommen“. Alles Spaß bisher? Der Bundespräsident darf erst als Zweiter: „Jetzt aber sind wir mitten in der dritten Welle!“ Schön onduliert recycelt er seine Rede von Ostern vor einem Jahr, da wußte er schon: „Großeltern zerreißt es das Herz, nicht wenigstens an Ostern die Enkel umarmen zu können“.
04.04.2021 17:21:17 [Unbesorgt]
Blamieren mit Parteivorsitzenden – Hennig-Wellsow bei Lanz
„Darüber diskutiert die Partei noch“ ist die Standard-Unwissenheits-Ausweichfloskel von Susanne Hennig-Wellsow. Sie wusste bei Jung & naiv nicht, aus welchen Auslandseinsätzen sie die Bundeswehr abziehen wollte und sie weiß bei Lanz nicht, wie die steuerlichen Daumenschrauben aussehen sollen, die sie für „Vermögende“ fordert. Genügt es dem Lanz nicht, dass diese groß und schmerzhaft sein, aber mit marxistischer Gewissheit schon die Richtigen treffen werden? Offenbar nicht. Doch seit wann ist es dem der Macht dienenden Medienpöbel gestattet, die spinnerten Wolkengebilde linker Politik anzupusten? Gut gemacht, Herr Lanz! Sie sind direkt und mitten ins intellektuelle Vakuum vorgestoßen.
04.04.2021 18:47:05 [Dushan Wegner]
Ausnahmezustand und Ideologie
Thomas de Maizière verunsichert die Bevölkerung jetzt mit Stichworten wie »Ausnahmezustand« und »Einsatz der Bundeswehr im Inneren«. Was ist schiefgelaufen, dass so etwas überhaupt aussprechbar ist? Okay, durchatmen. Wir haben das erste Quartal 2021 hinter uns, und was uns in den ersten Tagen des Aprils um die Ohren gehauen wird, das ist ein Anlass, erstmal durchzuatmen – doch eine Meldung sticht selbst in diesen im unguten Sinne »atemberaubenden« Zeiten hervor.

Wer den Namen »Thomas de Maizière« hört, der denkt vielleicht zuerst an jenen Moment unabsichtlicher Wahrheit: »Ein Teil dieser Antworten würde die Bevölkerung verunsichern.« Sein Nachfolger im Innenministerium wurde bekanntlich der bayerische Bettvorleger.

04.04.2021 18:52:52 [Multipolar]
Eve of destruction? Eine Mutmaßung
Befürworter wie Kritiker der aktuellen Corona-Maßnahmen sind sich in einem wesentlichen Punkt einig. Sie alle neigen zu der Annahme, dass diejenigen, die uns durch diese nicht enden wollende Krise steuern, eine klar definierte Agenda verfolgen, dass sie – ungeachtet aller Turbulenzen und „Debakel“ ihres Krisenmanagements – das Heft des Handelns in der Hand halten, dass sie wissen, was sie wollen und was sie tun. Tatsächlich? Spricht nicht, ganz im Gegenteil, vieles dafür, dass die Corona-Politik längst aus dem Lot und außer Kontrolle geraten ist? Dass der „Krieg gegen das Virus“ nur Leid und Zerstörung und viele Verlierer hinterlässt? Dass also – bewusst oder unbewusst – gewaltige Destruktivkräfte entfesselt wurden, die inzwischen ein Eigenleben führen?
05.04.2021 06:38:06 [Gift am Himmel]
Freimaurerei: Der Todestrieb der Menschheit
Wie wir in der Vergangenheit gezeigt haben, führt jede kategorische und metaphysische Leugnung der moralischen Ordnung unweigerlich zu radikalen Täuschungen und manchmal zu verdeckten Operationen. Die Freimaurerei ist als Geheimgesellschaft und judaisierende Bewegung nicht nur Teil dieser Täuschungen, sondern auch deckungsgleich mit jüdischer Magie und Mystik. Nur jene Freimaurer aus den den höheren Graden wissen tatsächlich, was genau vor sich geht. Je tiefer der Adept eindringt, desto talmudischer sind die Geheimnisse, die ihm offenbart werden.
05.04.2021 06:39:46 [Antikrieg]
Von der Osterruhe Richtung Sommerkoma
Mit Gewissheit kann über die derzeitige Entwicklung in Deutschland und Österreich eines gesagt werden: in beiden Ländern läuft eine Verwüstungs- und Vernichtungsaktion in einem beispiellosen Ausmaß, die offensichtlich von den jeweiligen Regimes nicht nur mitbetrieben, sondern aggressiv und bewusst gesteuert wird. Umfangreiche Gebiete der menschlichen Kommunikation und Kultur sowie ein großer Teil der Wirtschaft werden voll an die Wand gefahren. Es widerspricht jeder Vernunft und lässt sich von jedem ausrechnen, der des kleinen 1x1 mächtig ist: ohne Einnahmen kann man kein Geschäft betreiben.
05.04.2021 06:41:08 [Post-von-Horn]
Der Minister für heiße Luft
Kaum ein Minister der Bundesregierung hat seit Beginn der Pandemie so viel heiße Luft produziert wie Gesundheitsminister Spahn (CDU). Das jüngst Beispiel: Er plaudert in der nachrichtenarmen Zeit der Osterfeiertage über die guten Aussichten für jene, die geimpft sind. „Wer vollständig geimpft wurde, kann in Zukunft wie jemand behandelt werden, der negativ getestet wurde“, erklärte er. Spahns Geplauder lenkt von der trüben deutschen Impfbilanz ab. Die erste Impfung erhielten gerade mal etwas mehr als 12 Prozent der Bürger, die zweite bisher nur gut 5 Prozent.
05.04.2021 09:50:43 [Polit Platsch Quatsch]
Blut ist dicker: Ausgangssperre mit Ahnentafel
Ostern das noch mal das vom Grundgesetz verbriefte Recht auf Freizügigkeit im gesamten Bundesgebiet nutzen? Am Karfreitag ein Osterfeuer mit Freunden machen? Am Ostersonntag abends auf ein Gläschen zum Nachbarn? Nein, der Ausnahmezustand hat kurz nach der ausgefallenen Osterruhe der Kanzlerin eine neue Qualität erreicht: In mehreren Städten, Gemeinden und Landkreisen sind nächtliche Ausgangssperren als neues Zwangsinstrument in den Waffengürtel der Quarantäneüberwacher gewandert. Die Polizei in Mecklenburg-Vorpommern bewacht plötzlich wieder die Landesgrenze und lässt Fahrzeuge mit auswärtigen Kennzeichen umkehren.
05.04.2021 11:59:06 [Die Freiheitsliebe]
Es braucht demokratische Kontrolle der Pharmaindustrie
Die Corona-Pandemie führt uns mit weltweit fast drei Millionen Toten vor Augen, wie zerstörerisch Kapitalismus ist. Menschenleben werden trotz des Ernsts der Lage gegen Profite ausgespielt. Wollen wir diese Krise lösen, braucht es eine demokratische Kontrolle der Pharmaindustrie.

An der unsichtbaren Hand des Marktes klebt Blut. Auch wenn wir jetzt Impfstoffe gegen Covid-19 haben, heißt das nicht, dass die Pandemie praktisch besiegt ist. Das Virus wird sich in den Bevölkerungsteilen der Welt halten, wo keine Immunität erreicht wird. Der Impfstoff wird nicht nach Bedarf verteilt, sondern dorthin, wo Profit damit zu machen ist.

05.04.2021 12:09:15 [ScienceFiles]
Diktatur ist ein Meister aus Deutschland
YouTube zensiert Boris Reitschuster. Als denjenigen, die angeblich rechts sind, die Meinungsfreiheit beschnitten wurde, hat sich kein Widerstand geregt.
Als Regierungen Kritiker ihrer Politiken zensiert haben, hat kaum jemand Widerstand geleistet.
Als Präsidenten und Menschen mit der falschen Meinung von Plattformen gelöscht wurden, haben die Ideologen applaudiert.
Als die Gesetze verschärft und die Freiheit erdrosselt wurde, haben sich viele ins Bett gelegt und sind in der Hoffnung eingeschlafen, dass sich nach dem Aufwachen alles als schlechter Traum herausstellt.

05.04.2021 14:00:24 [Tichys Einblick]
Lockdown und das Ende der Demokratie
Als ich zu Beginn der Coronavirus-Krise geschrieben habe, daß der Lockdown und seine Konsequenzen den größten Umbruch in der Geschichte Westeuropas seit dem Ende des Zweiten Weltkriegs darstellen würde, wurde diese Meinung von vielen Lesern und Kommentatoren als allzu pessimistisch betrachtete. Heute, nachdem sich die Situation in fast einem Jahr kaum verbessert, ja in vielerlei Hinsicht noch eher verschlechtert hat, stehen wir vor den Früchten unserer Fehlentscheidungen. Denn es ist nicht die Pandemie, die die europäische Gesellschaft zerstört, sondern die Art und Weise, wie die Regierungen und internationalen Institutionen darauf reagieren.
05.04.2021 14:13:13 [Dushan Wegner]
Die Schatten sind fake
Was unterscheidet einen Witz, zumindest einen guten, von den Nachrichten? In jedem Witz steckt ein wahrer Kern! – Im Ernst aber: Was, wenn die Nachrichten nicht einmal die Umrisse der Wahrheit zeigen?! Wenn einer, etwa weil er zuvor gewaltsam befreit wurde, das Licht und die wahren Gegenstände sähe, und dann zurückgeführt würde, dann käme er zuerst überhaupt nicht zurecht in der Schattenwelt – und man würde ihn verhöhnen und darauf schließen, dass jeder Ausflug an die Oberfläche schädlich ist. Wenn einer aber seine Mitgefangenen gar befreien wollte, damit sie gemeinsam die Dinge hinter den Schatten sehen, dann würde man ihn dafür gleich erschlagen (wie heute die Terrorbanden der Antifa auf jeden einschlagen, der Menschen ermutigen will, sich nicht in den geistigen Gleichschritt-des-Tages einzusortieren).
05.04.2021 15:56:45 [Deliberation Daily]
Hinter den 16 Bergen bei den 16 Zwergen
Als im März 2020 die Corona-Pandemie Europa und Nordamerika erreicht hatte, reagierten die Länder sehr unterschiedlich auf die neue Gefahr. Noch unterschiedlicher als die Reaktionen allerdings stellten sich die Resultate heraus: während Deutschland extrem glimpflich durch das Frühjahr kam, stapelten sich etwa in Italien und Spanien die Leichensäcke, schossen die Todeszahlen in USA und Großbritannien steil in die Höhe. Die Bewertungen der deutschen Pandemiepolitik waren generell positiv. Was auch immer es war, man war davongekommen. Im März 2021 hat sich das Bild völlig gewandelt. Die deutsche Corona-Politik gilt als episches Desaster, der glimpflichte Verlauf vom Frühjahr 2020 als reines Glück.
05.04.2021 18:40:29 [Tichys Einblick]
Die Falschen gerettet
Als die stimulierenden Effekte der EZB-Niedrigzinspolitik im Sommer 2019 endgültig verpufft waren und die deutsche Wirtschaft kurz vor der Rezession stand, kündigte Bundesfinanzminister Olaf Scholz (SPD) die Wiederauflage der vermeintlich so erfolgreichen Wirtschaftspolitik seit der Finanzkrise 2008 an. Deutschland habe so solide Finanzgrundlagen, dass wir „in der Lage sind, mit vielen, vielen Milliarden gegenzuhalten, wenn tatsächlich in Deutschland und Europa eine Wirtschaftskrise ausbricht“, sagte er im Bundestag. Das sei „gelebter Keynesianismus, … das ist eine aktive Politik gegen die Krise – aber dazu muss sie dann erst mal da sein“, sagte Scholz weiter.
05.04.2021 18:47:31 [Zeit Online]
Ein etwas anderer Corona-Test
Europa, Bund, Kommune: Wer kriegt die schlechtesten Zensuren im Covid-Kampf? Bei Anne Will beschwor Angela Merkel ihre Machtlosigkeit. Deutschland torkelt der dritten Welle entgegen. Wer hat die beste Leistung gezeigt – die EU, Berlin oder ganz unten die Gemeinde? Brüssel bekommt eine Vier, Berlin ebenfalls, ein Impfzentrum in München eine Eins minus.

Dieser Autor gehört seit letzter Woche zu den Fast-Erlösten, zusammen mit den elf Prozent der deutschen Bevölkerung, die mit einer Erstimpfung gesegnet wurden. Zum Vergleich: Israel 59 Prozent, UK 51, USA 43. Dieses Trio gehörte im vergangenen Sommer zu den größten Losern, derweil Deutschland weltweit als Vorbild gefeiert wurde.

06.04.2021 06:46:20 [Einartysken]
Vandana Shiva über die Zerschlagung von Bill Gates‘ Imperium
In diesem Interview spricht Dr. Vandana Shiva über die Bedeutung und die Vorteile der regenerativen Landwirtschaft und ein zukünftiges Projekt von Regeneration International, bei dem wir zusammenarbeiten werden.

Wir sind derzeit mit enorm mächtigen Technokraten konfrontiert, die wild entschlossen sind, den Großen Reset einzuleiten, der den fortlaufenden Transfer von Reichtum und Ressourcenbesitz von den armen und mittleren Klassen zu den Ultra-Reichen vollenden wird.

06.04.2021 07:05:27 [Conservo]
„Das ist eine Schmierenkomödie!“
Während der Aussprache zum EU-Wiederaufbaufonds ließen SPD, Linke und Grüne am 25. März im Bundestag alle Masken fallen und bekannten öffentlich: Wir wollen die Fiskalunion!

Von der deutschen Öffentlichkeit – mal wieder – weitestgehend unbeachtet ereignete sich im Deutschen Bundestag am vergangenen Donnerstag, 25. März ein verbaler Schlagabtausch, der deutlich machte, wie entzweit die beiden Regierungspartner CDU/CSU und SPD tatsächlich sind und wie schlecht es steht um Deutschlands staatliche Souveränität.

06.04.2021 09:29:15 [Polit Platsch Quatsch]
Nervöse Führer: Die Sehnsucht nach der harten Hand
Noch härter,noch schärfer, noch strenger müssen sie werden, die "Corona-Regeln" (DPA) gegen die weitere Ausbreitung der britischen Mutation. Das Volk sehnt sich nach Leitung, nach Führung und einer harten Hand, die Reste des Förderalismus stehen 87 Jahre nach Hitlers "Gesetz über den Neuaufbau des Reiches" vom 30. Januar 1934 wieder vor dem Ende.

Untauglich in Krisenzeiten, in denen es um das blanke Überleben geht. Um ein "einheitlicheres Vorgehen im Kampf gegen die Pandemie" unabhängig von den gänzlich unterschiedlichen Bedingungen und Voraussetzungen in den einzelnen Ländern und Regionen durchsetzen zu könne, müsse "die föderale Struktur neu gestaltet" werden.

06.04.2021 09:32:46 [Telepolis]
Corona-Exit: Verantwortung und Haftung statt Bürokratie und Verbote
Warum die Medien schlimmer versagen als die Politik und wie wir aus dieser Nummer herauskommen. Einige konkrete Vorschläge: 77.000 Tote, ein anhaltender Lockdown, die dritte Welle und kein Ende in Sicht: Der Frust ist groß. Politiker, insbesondere wenn sie fragwürdige Entscheidungen treffen, sind ein willkommenes Ventil, diesen Unmut abzulassen. Man sollte sich aber klarmachen, dass sie weder die Hauptverantwortlichen der Pandemie sind, noch ein Zaubermittel an der Hand haben, diese zu beenden.

Bei aller berechtigten Kritik machen doch viele ihren Job. Eines können sie aber sicher nicht: es allen recht machen.

06.04.2021 11:14:24 [Gift am Himmel]
Rußlands Rolle bei der Abwendung des Völkermords an den syrischen Christen
In den letzten Jahrzehnten haben eine Handvoll Länder im Nahen Osten erlebt, wie der Extremismus seine häßliches Fratze erhob, um den interreligiösen Frieden zu untergraben. Wo immer es diesen Radikalen gelang, die Kontrolle zu erlangen, wurden religiöse Minderheiten, einschließlich Christen, zu ihren Opfern.

Ein anschauliches Beispiel für diesen Gedanken ist der Irak, wo unter dem Regime von Saddam Hussein 1,5 Millionen Christen lebten. Als dieses Land und die gesamte Region jedoch von radikalen extremistischen Kräften überrannt worden ist, begannen diese mit der Verfolgung der Christen, und infolgedessen verringerte sich die Bevölkerung Letzterer auf ein Zehntel.

06.04.2021 14:43:37 [Konjunktion]
Gaslighting: Das Werkzeug der Unterdrückung
Uns allen ist der alte Spruch “Alle Regierungen lügen.” bekannt. Ein Spruch, der keine Theorie ist. Er ist zu einer Tatsache geworden, wie die Geschichte immer wieder bewiesen hat. Nicht nur im Zuge der Plandemie und der bis vor wenigen Monaten für die meisten Menschen nicht vorstellbaren Propaganda muss diese Regel aber erweitert werden: “Alle Regierungen, alle Konzerne, alle Konzernmedien, alle Denkfabriken und alle von Konzernen finanzierten Aktivistengruppen lügen.” Es gibt einen Grund, warum das öffentliche Vertrauen in die meisten dieser Organisationen auf einem historischen Tiefstand ist, und das liegt nicht daran, dass sie von guten und ehrlichen Menschen geführt werden.
06.04.2021 14:46:09 [Polit Platsch Quatsch]
Hart, härter, Brücken-Lockdown: Kampf um grüne Zonen
Überall rote Punkte bei Twitter, überall Protest gegen den laxen Umgang der Bundesregierung mit der dritten Corona-Welle, überall eine wachsende Sehnsucht nach härteren Maßnahmen, neuen Auflagen, Beschränkungen und Schließungen. 54 Wochen nach Beginn des ersten Corona-Lockdowns in Deutschland wird immer deutlicher, dass die zärtlichen Schritte zur Pandemieeindämmung nicht mehr ausreichen. Weder der Wellenbrecher-Lockdown vom November noch der Weihnachtslockdown noch der dann bis mindestens Ende April verlängerte verschärfte November/Weihnachtslockdown zeitigen bislang die erwünschten Ergebnisse.
06.04.2021 19:02:30 [Egon W. Kreutzer]
Vernunft – Wille – Gefühl
Es gibt manche Erlebnisse, die einfach dauerhaft im Gedächtnis hängen bleiben und immer wieder Anlass geben, die eigenen Einstellungen und das eigene Verhalten daran zu reflektieren. Bei mir fand so ein prägendes Erlebnis statt, als nach der Musterung – die Wehrpflicht war damals noch auf 18 Monate festgesetzt – der sogenannte Eignungstest zu absolvieren war. Der Eignungstest, der dazu dienen sollte, festzustellen, bei welcher Waffengattung (Heer, Luftwaffe, Marine) und in welcher Verwendung der Wehrpflichtige mit seinen Kenntnissen und Fähigkeiten, aber auch mit seinen Vorlieben, Gewohnheiten und charakterlichen Stärken und Schwächen optimal eingesetzt werden könnte, wurde von einem Bundeswehrpsychologen geleitet.
07.04.2021 06:33:31 [QPress]
Das Volk und die Glücksritter der Kanzlerschaft
Wir sind als die Hauptbetroffenen derzeit lediglich Zuschauer großer Ereignisse. Das Geplänkel um die Kanzlerschaft nimmt gerade seinen Lauf. Dabei spielt es überhaupt gar keine Rolle, dass man sich innerhalb der Schwesterparteien CDU/CSU Haut wie die Kesselficker. Alles nur Show. Die allfällige Neuausrichtung der Gesellschaft, beziehungsweise die Errichtung eines komplett neuen Systems, geht gerade fulminant in eine völlig falsche Richtung und wie immer ohne Volksbeteiligung.
07.04.2021 06:35:45 [Recentr]
Fakten und Märchen zum „Great Reset“ und dem WEF
Wenn Megakonzerne in der Pandemie noch reicher werden, während viele kleinere Firmen untergehen, verunsichert dies die Menschen noch mehr. Eigentlich hätte es selbstverständlich sein sollen, dass angesichts der drohenden Pleitewelle und Schuldenberge die deutsche Bundesregierung die vielen Regulierungen zurückfährt, die „Energiewende“ abbricht und die klassische Autoindustrie schützt. Stattdessen ging es nahtlos weiter mit Energiewende und der Zerstörung der Autoindustrie. Wie üblich wird eine Krise mit neuen Schulden übertüncht.
07.04.2021 06:37:48 [Klaus Peter Krause]
Ein Sieg für die Freiheit mit Pauken und Trompeten
Eine Kundgebung wurde polizeilich verboten, aber das Verbot jüngst gerichtlich für rechtswidrig erklärt. Die Freiheitliche Partei Österreichs (FPÖ) hatte gegen das Verbot Beschwerde eingelegt und hat nun gewonnen. Das Verwaltungsgericht Wien hob das ursprüngliche Kundgebungsverbot auf und gab der FPÖ in sämtlichen (!) Beschwerdepunkten recht.

Wer liest, wie das Gericht seine Entscheidung begründet, muss feststellen: Österreichs „Freiheitliche“ haben mit Pauken und Trompeten obsiegt, und die Behörden sind ebenso spektakulär gescheitert. Die Entscheidung datiert vom 24. März 2021. Die Landespolizeidirektion Wien hatte eine von der FPÖ für Wien angemeldete Kundgebung untersagt. Motto der Kundgebung: „Für die Freiheit“ und „Allgemeine Information der FPÖ“.

07.04.2021 06:39:00 [Neuland Rebellen]
Bevor ein falscher Eindruck entsteht...
Man muss die CDU ja echt nicht mögen, um eines klarzustellen: So eine Ehrenerklärung ist ziemlich unehrenhaft – und nicht demokratisch. Natürlich gilt auch jeder aus der restkonservativen Union als unschuldig, bis man seine Schuld nachweisen kann. Entschuldigt man sich heute denn bloß noch vorab?

Nachdem innerhalb der Union mehrere Abgeordnete bei Maskengeschäften auffielen, unterschrieben alle Abgeordneten eine Ehrenerklärung. Darin erklärten sie, keine finanziellen Vorteile aus »pandemie­bezogenen Geschäften« erhalten zu haben. Einen solchen Schritt sah man als notwendig an, weil man auf den Druck der Öffentlichkeit und dem entstandenen Imageschaden reagieren musste.

07.04.2021 09:05:47 [Polit Platsch Quatsch]
Im Schatten der Seuche: Wie die Politik im Eiltempo den Staat umbaut
Im abendländischen Westen sagen sie gern, dass in China das Wort für Krise gleich dem Wort für Chance ist. Und sie halten sich dran, denn große Krisen sind immer die besten Momente, um große Entscheidungen zu fällen, ohne dabei beobachtet zu werden. Was in gewöhnlichen Zeiten notdürftig im Schatten von Fußballendspielen, wegweisenden Vorrundenbegegnungen bei großen Meisterschaften oder aber einfach tief in der Nacht versteckt werden muss, wenn niemand mehr zum Mondscheintarif telefoniert, kann in Zeiten der" pandemischen Lage von nationaler Tragweite" am hellerlichten Tage, vor aller Augen und ganz ungeniert beschlossen werden.
07.04.2021 09:09:15 [Deliberation Daily]
Politische Dehnübungen: Die grün-gelbe Kanzlerin
Der Niedergang der Volksparteien Union und SPD scheint unaufhaltsam. Statt Sammelbecken für alle wesentlichen gesellschaftlichen Gruppen fragmentiert sich die zivile Gesellschaft auch in Deutschland immer weiter. Die Sozialdemokraten sind ohnehin nur noch ein Schatten früherer erfolgreicherer Tage. Inzwischen beschleunigt sich jedoch auch der Zerfall der Unionsparteien, heruntergewirtschaftet von Angela Merkel als langjährigen CDU-Vorsitzenden, die Themen der politischen Neuzeit stets nur nach ihrem Gefährdungspotential abklopfte und neutralisierte. Doch die politische Neutralisierung lähmt das Land in einer verhängnisvollen Genügsamkeit, während die Christenparteien erst entkernt wurden und nun ideenlos vor dem Bürger stehen.
07.04.2021 09:13:02 [TauBlog]
Stand der Dinge
Die Wirkung von Lockdowns ist weiterhin mehr als zweifelhaft. Wissenschaft und Politik liefern immer noch keine brauchbaren Antworten auf die Frage, welche Maßnahmen wie wirken. Die Debatte ist bestimmt von Modellen und weniger von gesicherten Erkenntnissen. Dass harte Ausgangsbeschränkungen die Ausbreitung der Mutation gebremst hätten, ist in diesem Zusammenhang reine Propaganda. Niemand hat das untersucht. Vielmehr hat man einfach nur den Rückgang der Meldezahlen mit der Ausgangsbeschränkung in Verbindung gebracht (Korrelation), ohne zu prüfen, ob es auch einen kausalen Zusammenhang gibt.
07.04.2021 10:48:56 [Dushan Wegner]
Zur Straffung nach Istanbul
Prinzessin Angela steht auf der Burg und winkt keck den Männern zu, doch heimlich zahlt sie Ritter Erdogan, damit er am Fuß der Mauer steht und die Geladenen mit scharfer Lanze von der Prinzessin fort hält. Sogar die Chirurgen selbst sagen es, und sie sagen es nicht ohne Stolz: Die ästhetische Chirurgie bietet an, psychologische Probleme mit dem scharfen Skalpell zu lösen. Du fühlst dich nicht bewundert genug? – Wie wäre es mit einer kleineren Nase? Du magst nicht, wen du im Spiegel siehst? Könnte eine schnelle Straffung helfen? – Du willst nicht so alt aussehen, wie du dich fühlst? Probier doch eine Haartransplantation!
07.04.2021 13:02:09 [Polit Platsch Quatsch]
Knüppel aus der Gosse: Rezo, der Zerstörer
Damals im Mai vor der Seuche konnte ein Mann mit blauen Haaren noch richtig für Aufregung sorgen. "Rezo" musste nicht einmal seinen bürgerlichen Namen sagen, um die letzte deutsche Volkspartei bis aufs Blut zu peinigen. "Die Zerstörung der CDU" war danach zwar nicht vollendet. Zu viele Schicksale und nicht zuletzt das der deutschen Demokratie hingen vom Fortbestand ab. Doch ein kostbares Tabu war gebrochen: Ein im Grunde digital dahergelaufener Youtuber hatte den Parteizentralen, den Medienhäusern, den Firmen, Behörden und Institutionen die Instrumente gezeigt.
07.04.2021 14:41:19 [Konjunktion]
Ukraine: Warum kommt es gerade jetzt zu einem Wiederaufflammen des Konflikts?
Seit einem Jahr dominiert die “Corona-Berichterstattung” die Schlagzeilen. Kein Tag ohne Panik- und Angstmache, ohne “neue Horrorzahlen” oder ohne “Berichte mit erhobenen Zeigefinger”.

Dabei dreht sich die Welt auch in vielen anderen Dingen weiter und eines dieser Dinge, ist der wiederauflammende Konflikt – nein, die gewollte Eskalation des Kriegsgeschehens in der Ukraine.

In den letzten Tagen wurden vermehrt Bilder und Videos auf den sozialen Netzwerken geteilt, die Truppen- bzw- Maschinentransporte (LKWs, Panzer, usw.) zeigen.

07.04.2021 14:42:33 [Unbesorgt]
Urlaubsverbot oder Verschwinden auf Usedom und in Rostock
Neben anderen griffigen Sentenzen gibt es einen besonderen Satz, um dessen Erklügelung ich Michael Klonovsky beneide: „Ich komme aus der DDR, ich komme aus der Zukunft.“ Dieser Satz fasst sehr treffend eine nur schwer erklärbare Sammlung von Erfahrungen und Fähigkeiten zusammen, die nur haben kann, wer vor 1989 zumindest kurze Zeit seines Jugend- oder Erwachsenenlebens zwischen Elbe und Oder verbracht hat. Schwer erklärbar deshalb, weil die Reflexe des Publikums meist in die Behauptung münden, die Bundesrepublik ginge schnurstracks in Richtung DDR 2.0 oder es sei in Wirklichkeit der Westen, der 1990 vom Stasi- und SED-verseuchten Osten geschluckt wurde.
07.04.2021 17:18:57 [Der Freitag]
Die politische Dimension der Ausgangssperre
Ein herrschaftskritischer Kommentar über das politische Instrument der Ausgangssperre und die Konsequenzen für Staat und Gesellschaft: Es ist Anfang April und die Zahl der nachgewiesenen Virusinfektionen nimmt seit einigen Wochen wieder stark zu, sodass deutschlandweit wieder nächtliche Ausgangssperren greifen. Lockdown und Ausgangssperre stellen seit gut einem Jahr dominante staatliche Instrumente der Viruseindämmung dar, ohne die es laut politischen Entscheidungsträgern zu einem „totalen Kontrollverlust“ käme. Im großen Stil ignoriert wird nach wie vor die Beobachtung, dass diese Instrumente weniger die Bevölkerung vor dem Virus schützen, als Staaten vor dem eigenen Versagen im Umgang mit der Pandemie.
07.04.2021 18:37:57 [Meine Meinung Meine Seite]
Ein Bittgang
Die EU- Spitze, nämlich die EU- Kommissionspräsidentin Ursula von der Leyen und Ratspräsident Charles Michel, tingelten in die Türkei, um sich in Ankara mit dem türkischen Präsidenten Erdogan zu treffen. Eigentlich wollten sie sich mit Erdogan treffen, so hieß es zumindest, um ihn ein wenig zurecht zu stutzen. Sie wollten ihm klarmachen, so wurde berichtet, dass die Türkei die internationalen Menschenrechtsregeln selbstverständlich einzuhalten habe und dass für die EU „die Achtung der Grundrechte und der Rechtsstaatlichkeit von entscheidender Bedeutung sei“. Angeblich wurde auch vermittelt, dass der türkische Ausstieg aus der Istanbul- Konvention zum Schutz der Frauen besorgniserregend sei und die Türkei diesen Schritt doch rückgängig machen soll.
07.04.2021 18:48:20 [FirstLife]
Die Selbstzerstörung der CDU
Impfdebakel, Maskenaffäre, kassierter Oster-Lockdown – die CDU steht am Rande der politischen Lächerlichkeit, die verlorenen Landtagswahlen sprechen Bände. Mitten in der Corona-Krise fällt ein Kartenhaus aus politischem Versagen und persönlicher Vorteilnahme zusammen. Ein Kommentar: Anfang des Jahres nahm die Kritik an der Gesundheitspolitik Jens Spahns zu. Sie richtete sich gegen die nur schleppend anlaufenden Impfungen und die in viel zu geringer Zahl bereitgestellten Impfdosen. Zu allem Überfluss kassierte die Kanzlerin Ende Februar auch noch Spahns Ankündigung, ab März Schnell- und Selbsttests für alle Bürger bereitzustellen.
08.04.2021 09:28:24 [Alles Schall und Rauch]
Krieg zwischen Ukraine und Russland?
Offene und weitreichende Feindseligkeiten scheinen in der Ostukraine unvermeidlich zu sein. Kiew befindet sich auf dem Kriegspfad, mit der "unerschütterlichen" Unterstützung der USA und der NATO. Die jahrelange penetrante anti-russische Propaganda des Westens hat die Bevölkerung der EU und der USA auf den Krieg vorbereitet und Russland zum Oberbösen gemacht ... und was böse ist darf man ohne Skrupel vernichten.

Schliesslich sind die Russen und besonders Putin an allem schuld was im Westen an Schlechtem passiert. Vom Zusammenbruch der Wirtschaft, Hyperinflation, Hygienediktatur und Verarmung müssen die Regime ablenken, deshalb muss ein Krieg her.


08.04.2021 09:30:02 [Polit Platsch Quatsch]
Ausgangssperre mit Ahnenpass: Freiheit für Blutsverwandte
Das Wetter hilft dem Kanzleramt, dem künftigen Kanzlerkandidaten und damit dem Bestand der gesamten ins Wackeln geratenen Demokratie. In einer Phase, "in der das Impfen Tempo aufnimmt" (Armin Laschet), in der die "Hausärzte zum Einsatz" (Laschet), die Bundeswehr im Inneren an der Impffront angreift und die Osterruhe Richtung Pfingsten gesehen doch noch eine Chance bekommen könnte, zeigen Ausgangssperren, warum noch jeder Sieger eines Krieges zuerst zu diesem Mittel griff, hatte er sein Feindesland erst erobert. Ausgangssperren, im Grundgesetz als unveräußerliches und unverletzliches Grundrecht des Staates festgeschrieben, in das "nur auf Grund eines Gesetzes eingegriffen werden" darf, erweisen sich in den hot spots und außer Kontrolle geratenen Modellregionen als schärfstes Schwert der Seuchenbekämpfung
08.04.2021 09:35:40 [Publico]
Der Verblendungsweltmeister
Bundespräsident Steinmeier mahnt mehr Zusammenraufen an, lobt den Verzicht, warnt vor Zweifeln und klopft Leuten auf die Schulter, die wegen des Lockdowns vor der Pleite stehen. Niemand verkörpert die politische Klasse so gut wie er. Der frühere Präsident des Bundesverfassungsgerichts Hans-Jürgen Papier gehört zu denen, die bedächtig formulieren, dabei aber auch zu Sätzen gelangen, die etwas aussagen. In einem Interview mit der Welt gab Papier im März sein Urteil über die Pandemie-Politik der Bundesregierung ab, aber auch über das grundsätzliche Verhältnis zwischen Staat und Bürgern.
08.04.2021 11:09:42 [Peds Ansichten]
Die Kunst der offenen Briefe
In der aktuellen Krise hat die Machtelite Oberwasser gewonnen, hat die Staatsgewalten, die Parteien, die Medien, die Konzerne, die Verbände (insbesondere deren Funktionäre) wie auch die breite Mehrheit der Bevölkerung hinter sich gebracht und die verbliebene Opposition weitgehend marginalisiert, stigmatisiert und unsichtbar gemacht. Der Diskursraum ist künstlich verengt, das Machtgefälle und die Unterdrückung abweichender Sichtweisen sind bedrohlich angewachsen.

Wie können Menschen mit unterschiedlichen Meinungen in einer asymmetrischen Situation wie dieser im politischen Raum weiterhin vernünftig miteinander kommunizieren? Wie können die für eine Demokratie konstituierenden Meinungsbildungs- und Entscheidungsfindungsprozesse unter diesen Bedingungen aufrecht erhalten werden?

08.04.2021 13:03:56 [Dushan Wegner]
Ein Los in der Trostlotterie
Unter Merkel und ihren Helfern wird Deutschland zum Sanierungsfall. Geld verliert täglich an Wert, und Politiker glauben sich nicht einmal selbst. Wie und womit soll sich der Bürger trösten? »Was ist bloß aus unserem Land geworden?«, so fragt sich heute mancher Bürger. »Nach 16 Jahren Merkel ist Deutschland in vielen Bereichen ein Sanierungsfall«, so wird aktuell Wolfgang Reitzle zitiert.

Wir fühlen uns wie müde, abgekämpfte Sportler, wie Langstreckenläufer, denen sich die eigenen Beine derart gründlich verknotet haben, dass die Frage, ob man von anderen Läufern überholt wird (man wird, und wie!), sekundär geworden ist. Sports, wo sind deine Muskeln abgeblieben?!

08.04.2021 14:52:06 [Polit Platsch Quatsch]
Kurz und knackig: Kommt jetzt der Sekunden-Lockdown?
Ein Jahr lang ließen sie es langsam angehen, langsam und freundlich. Irgendetwas war immer geöffnet, die Sonnenstudios und Wettannahmestellen sowieso, die Baumärkte zuweilen und mancherorts, anderswo aber auch die Abgeordnetenbüros, Baustellen, Kirchen und Dönerbuden. Lockdown in Deutschland war ein buntes Gewimmel an Maßnahmen von großer Diversität, nicht immer ganz durchschaubar für jeden, aber erträglich, weil alle anderen auch nicht besser verstanden, weshalb bei Maischberger und Lanz wildfremde Menschen stundenlang beieinander hocken und Aerosole austauschen konnten, während man selbst der eigenen Oma nur noch am Balkon zuwinken durfte.
08.04.2021 15:03:30 [ScienceFiles]
Karl Lauterbach, der MDR und Long COVID
Was sich derzeit in Medien abspielt, das hat mit Berichterstattung nur am Rande zu tun.
Die Art und Weise, in der in Medien Angst geschürt wird, mit der ein Ball ins Feld geworfen wird, den Leute wie Karl Lauterbach dann aufnehmen, die hat nichts mehr mit lauterem Journalismus zu tun. Womit es etwas zu tun hat, das ist eine Frage, die wir an dieser Stelle einmal an unsere Leser weitergeben. Mindestens 10% derjenigen, die an COVID-19 erkranken, so behauptet Lauterbach, würden “Long COVID” entwickeln. Selbst bei Kindern bilde sich Long-COVID aus, wie Lauterbach mit Bezug auf “Reha Spezialisten” behauptet. Zu diesen Behauptungen verlinkt er einen Beitrag des MDR, so dass man annehmen muss, was Lauterbach behauptet, werde im Beitrag des MDR irgendwie belegt.

09.04.2021 09:00:14 [Polit Platsch Quatsch]
Giganten der Urzeit: EUfholjagd beim Impfen
Als Großbritannien den ersten Corona-Impfstoff zuließ, brüteten Europas beste Zulassungsexperten in 27 nationalen Behörden noch über ihren Zulassungsfaxen. Wenn sie fertig seien, werde der EU-Impfstoff aber sehr viel sicherer sein als der im ausgetretenen Königreich, versprach die deutsche Spitzenpolitik. Als Großbritannien, geführt von einem exzentrischen Clown, dann zu impfen begann, wurde zumindest der deutsche Gesundheitsminister nervös. Öffentlich mahnte er die EU-Zulassungsbehörde EMA, nun mal langsam in die Schuhe zu kommen. Vier Wochen nach den Briten, mittlerweile wurde auch in den USA, Israel und eine ganzen Reihe weiterer Staaten bereits geimpft, war die EMA soweit.
09.04.2021 10:47:32 [Konjunktion]
Die anstehende Cyberübung “Cyber Polygon 2021”
Vielen meiner Lesern ist die vom Weltwirtschaftsforum durchgeführte Simulationübung Event 201 bekannt, die der aktuellen Plandemie vorausging. Event 201 nahm die Plandemie auf unheimliche Art und Weise vorweg und schien sie letztlich vorherzusagen. Zudem gab es weitere Plandemie-Übungen wie Clade X oder Dark Winter.

Was jedoch weit weniger Menschen wissen, ist, dass das Weltwirtschaftsforum eine ähnliche Simulation im Bereich der Cyper-/IT-Sicherheit, Cyber Polygon 2020, durchgeführt hat. Diese Veranstaltung fand im Jahr 2020 statt und sagte ebenfalls eine globale Katastrophe voraus.

09.04.2021 11:24:53 [Neuland Rebellen]
Ich, ein Dunkeldeutscher
Helles neues Deutschland. Was sind wir doch weltoffen, zuversichtlich und harmonisch geworden. Vom deutschen Boden aus soll eine bessere Welt entstehen. Eine gerechtere? Nee, niemand hat die Absicht Mauern einzureißen. Die bessere Welt soll eine identitätsstiftende sein. Eine, in der auf die richtige Sprache geachtet, Müll getrennt und auf Befindlichkeiten Rücksicht genommen wird. Ein Safe Space halt, eine Wohlstandssphäre für hochsensible Zaungäste. In dem sollten dann auch Dispute eingedämmt werden. Unliebsames Verhalten wird natürlich schroff getadelt, denn in der besseren Welt stimmen die Guten den Ton an – alle anderen: Böse.
09.04.2021 13:02:19 [Gift am Himmel]
Der Steuerbescheid als Basis für den finanzwirtschaftlichen Irrsinn der Regierung
Wir erleben nicht den Amerikanischen Traum. Wir erleben einen finanziellen Alptraum. Die US-Regierung – welche die derzeitige Administration umfaßt – gibt Geld, das sie nicht hat, für Programme aus, die sie sich nicht leisten kann, und „wir, die Steuerzahler“ sind diejenigen, die gezwungen sein werden, die Rechnung für den finanzpolitischen Wahnsinn der Regierung zu schultern.

Wir wurden von Politikern für dumm verkauft, die uns versprochen haben, die Staatsschulden abzubauen.

09.04.2021 13:04:39 [Konjunktion]
EZB: Bilanzausweitung im März um 342 Milliarden Euro – Was steckt dahinter?
In der Woche vom 19. auf den 26. März hat die Europäische Zentralbank ihre Bilanzsumme von 7.162,2 Milliarden Euro auf 7.505,0 Milliarden Euro erhöht (letzter aktuell verfügbarer Stand vom 2. April beträgt 7.494,1 Milliarden Euro). Die Bilanzausweitung um 342,8 Milliarden Euro entspricht eine Erhöhung um satte 4,8% innerhalb von einer Woche. Unter diesen Längerfristigen Refinanzierungsgeschäften fallen auch die Pandemic emergency longer-term refinancing operation (PELTRO, Längerfristige Refinanzierungsoperation bei Pandemienotfällen) bzw. Pandemic Emergency Purchase Programme (PEPP).
09.04.2021 13:05:50 [Antikrieg]
Wie die Götter Großbritanniens Premierminister verrückt machten
In der berühmten Hymne "Rule Britannia" singen die Briten seit Hunderten von Jahren stolz, dass sie niemals Sklaven sein werden: doch in seinen Nietzsche'schen Wahnsinnsträumen macht Boris Johnson sie zu Slapstick-Clowns.

"Diejenigen, die die Götter vernichten wollen, machen sie zuerst verrückt."

Ich war noch nie ein Bewunderer von Friedrich Nietzsche oder den grandiosen, meist absurden und abstoßenden Aussagen, die als seine sogenannten "Gedanken" durchgehen. (Wie der irische politische Philosoph Conor Cruise O'Brien feststellte: Wenn Sie glauben, dass Nietzsche die Ausrottung "kleinerer" Rassen wie der Slawen nicht enthusiastisch begrüßt und gefordert hat, dann irren Sie sich).

09.04.2021 13:14:29 [Polit Platsch Quatsch]
Joe Biden: Lasset die Kindlein zu mir kommen
Es anders machen als der grausame Vorgänger wollte er, ein liebevoller Präsident sein für die gesamte Welt, versöhnend und verzeihend wie Tom Kirkman aus der Fantasie-Serie "Designated Survivor", der keine Parteien kennt, sondern nur richtige und falsche Entscheidungen. Joe Biden kam ins Amt, beladen mit einem bis zu den Sternen ragenden Sack aus Erwartungen, so viele und so unterschiedliche, dass selbst ein leistungsfähiger Mann im Vollbesitz seiner körperlichen und geistigen Kräfte Mühe gehabt hätte, in alle auseinanderstrebenden Richtungen zugleich zu marschieren.
09.04.2021 13:20:40 [Dushan Wegner]
System Lockdown
Gegen die gefährlichen Maßnahmen des Merkelapparats in der Sache zu argumentieren wird wenig fruchten. Lockdown u. Co. sind zum eigenen System geworden. Der Zweck des Lockdowns ist der Lockdown. Nehmen wir an, jemand teilt Ihr Gehirn sauber in mehrere Teile (ich leihe mir hier ein bekanntes Denkexperiment). Bekanntlich kann man auch mit bloß einem Teil des Gehirns zumindest funktionsfähig bleiben (was so manche Phänomene dieser Tage erklären könnte), und in unserem nur gedachten Experiment soll jeder einzelne Gehirnteil weiter funktionieren.

Die Persönlichkeit eines Menschen, also das, was ein jeder sein Ich nennt, ist eine Funktion des Gehirns. Wie viele »Ich« gibt es, wenn das Gehirn geteilt wird?

09.04.2021 14:42:56 [ScienceFiles]
Merkel-Deutschland im DDR-Autoritarismus
Seit dem 25. März 2020, dem Tag, an dem der Bundestag eine epidemische Lage von nationaler Tragweite ausgerufen hat, also einen Ausnahmezustand verkündet hat, wird Deutschland am Bundestag vorbei von einer Art Zentralkomittee oder einer Art Politbüro regiert, das in der Verfassung nicht vorgesehen ist, und in dem Computerspiele spielende Ministerpräsidenten der Länder mit der Bundesregierung kungeln. Damit ist eine Form des Ausnahmezustandes geschaffen, wie es sie seit der Weimarer Republik in einem demokratischen Deutschland nicht gegeben hat.
09.04.2021 15:57:36 [Zettels Raum]
Die Wut im Bauch
Ein persönlicher, vielleicht auch mein (vor)letzter Artikel. Dieser Artikel ist eine innere Reflektion, nicht redigiert, nicht überdacht und in Wut geschrieben. Wen das nicht interessiert, der braucht ab hier nicht weiter zu lesen.

Ich kann nur schlecht beschreiben welche Wut ich inzwischen empfinde, der Begriff des Wutbürgers, der noch vor wenigen Jahren so gerne verwendet wurde, um diejenigen, die eine Zerstörung ihrer Lebensgrundlagen befürchteten, zu brandmarken, beschreibt die Situation nicht einmal schlecht. Man ist erwachsen, man hat gelernt seine Aggressionen zu kanalisieren, sich zu benehmen, keine Kraftausdrücke zu benutzen, sich zurück zu halten und die Form zu wahren.

09.04.2021 17:09:42 [Fliegende Bretter]
Fare well, Duke!
Nein Bonetti, hier muss ich ausnahmsweise widersprechen: Der Beziehungsstatus, in den Elizabeth II. von England nunmehr übergegangen ist, heißt nicht 'Single', sondern 'Witwe'. Ich bin alles andere als Monarchist und der Ansicht, die blaublütige Bande und diverse gekrönte Häupter hatten lange genug Gelegenheit, den Kontinent einigermaßen anständig zu regieren und überwiegend vergeigt. Vielleicht waren es nach der Aufklärung die modernen Massenmedien, die den Aristokraten endgültig den Nimbus genommen und offenbart haben, was sie wirklich waren und sind: Ziemlich durchschnittliche Leute, denen die Geschichte nicht zu unrecht eine überwiegend repräsentative Rolle zugewiesen hat.


10.04.2021 06:28:49 [Der Überflieger]
Der schleichende Tod von Alexej Nawalny
Olga Michailowa, die Anwältin des Kreml-Kritikers Alexej Nawalny, hat verlautbart, dass ihr Mandant bereits 13 Kilogramm abgenommen habe und sich im Hungerstreik befinde. Der in einem Straflager, oder wie er selbst es bezeichnet, Konzentrationslager befindliche Regime-Kritiker, werde seinen Hungerstreik, trotz Verschlechterung seines Gesundheitszustandes, fortsetzen.

Fakt ist, dass bei ihm offiziell 38,1 Grad Fieber gemessen und starker Husten attestiert wurde. Drei seiner Mitgefangenen sind übrigens, wegen Tuberkulose, in ein Krankenhaus verlegt worden.

10.04.2021 06:41:14 [KenFM]
Nawalny als „Regimechanger“
Am 20. August 2020 erlitt der russische Oppositionspolitiker Alexej Nawalny während eines Inlandfluges einen Schwächeanfall und musste nach einer Notlandung in Omsk in einer Klinik behandelt werden. Wenig später wurde er mit Einwilligung der russischen Regierung in die Berliner Charité ausgeflogen, wo er mehrere Tage im Koma lag. Noch bevor Fakten bekannt waren, geschweige denn eine erste Untersuchung des Vorfalls stattgefunden hatte, wurde von westlichen Politikern und Journalisten behauptet, auf den „Kreml-Kritiker“ sei auf Anordnung oder jedenfalls mit Wissen Wladimir Putins ein Mordanschlag mit einem russischen Nervenkampfstoff aus der Nowitschok-Gruppe verübt worden.
10.04.2021 10:46:38 [Meine Meinung Meine Seite]
Nichts zu lästern
Es gibt viel Diskussionsstoff über die Corona- Impfstoffe Sputnik V und AstraZeneca, der jetzt übrigens auf Vaxzevria umgetauft wurde. Der russische Impfstoff Sputnik V wird in letzter Zeit ja auch für einzelne EU- Staaten interessant; auch Österreich ist bei den Verhandlungen über Lieferungen „auf den letzten Metern“, heißt es. Allerdings bedarf es noch einer Zulassung und da hakt es momentan. Die Europäische Arzneimittelagentur EMA, zuständig für die EU, hat es – wahrscheinlich aus politischen Gründen – nicht besonders eilig wegen angeblicher Unklarheiten bei den Informationen zum Impfstoff.
10.04.2021 11:07:45 [Polit Platsch Quatsch]
Vierte Phase des deutschen Schnell: Im Impfzugang
Es ist die vierte oder womöglich sogar schon fünfte Phase der großen deutschen Impfoffensive auf die tief eingegrabenen Virusstellungen im Land, die gerade schneller und immer noch schneller anläuft. Jetzt mischen gar die Hausärzte mit, zehntausende von ihnen stehen Kanüle im Anschlag bereit, jeder von ihnen war bereits wenigstens einmal im Fernsehen, um Hoffnung zu impfen. Weil es leider noch an Impfstoff fehlt - die Logistik des Transports der derzeit auf Halde liegenden rund vier Millionen Dosen krankt an EU-Umweltauflagen, Klagen von Menschenrechtsorganisationen, dem Streit zwischen EMA und Stiko und sie leidet unter Angriffen von Impfgegnergruppen, vor denen das BKA allerdings rechtzeitig gewarnt hatte - geht es voran, aber längst nicht so schnell wie versprochen.
10.04.2021 11:09:22 [Tichys Einblick]
Die Chefärztin hält Entmündigung für eine Therapie
Die Freiheit geht, das Virus bleibt. Ein Land wandelt sich zur kollektiven Anstalt. Der Zustand der Anstalt ist die eigentliche Katastrophe. Dienstag, Hauptbahnhof Berlin. Der ICE nach München hat nicht nur siebzig Minuten Verspätung, er ist auch gestopft voll. Die Leute sitzen auf den Gängen und zwischen den Türen auf dem Boden, essen, trinken ohne Mundschutz, quatschen, telefonieren, Kinder schreien. Ein Fest für Aerosole. Niemand protestiert, niemand verhindert es. Einzige Maßnahme: Das Bordbistro gibt keinen Alkohol aus. Die Bundesseuchenbekämpfer haben das Bundesunternehmen Bahn offenbar nicht auf dem Schirm.
10.04.2021 13:14:27 [Dushan Wegner]
Willkommen in der Realität
»Am Ende gewinnt immer die Realität«, so mahnten wir (und mahnen noch immer). Wir tragen es sogar auf T-Shirts! Nun, liebe Freunde, es wäre dann soweit: Willkommen in der Realität! Die Wichtigen und Weltbewegenden, sie sind keine Freunde des Sarkasmus – sagen sie. Sarkasmus, diese bittere Schwester des Witzes, wie stört sie doch jene, welche sich an die Ernsthaftigkeit klammern wie die alte Jungfer an ihren katholischen Ruf.

Sarkasmus kommt vom altgriechischen σάρξ. Sarx, das ist Fleisch. Der Geist ist willig, doch er wurde enttäuscht, und also wurde er sarkastisch.

10.04.2021 15:11:21 [Der Freitag]
Kampf gegen Rechts: Kampf gegen ein Phantom
"Kampf gegen Rechts" als Propagandaposse: Wichtige Ursachen für Fremdenfeindlichkeit werden ausgeblendet und nicht bekämpft – denn das würde das große Narrativ gefährden. In einem sehr interessanten Vortrag, den der Medienwissenschaftler Norbert Bolz im Juni 2019 vor der Desiderius-Erasmus-Stiftung gehalten hat, kommt er auch auf den "Kampf gegen Rechts" zu sprechen. Für alle politischen Parteien (damit meint er alle von der Linken bis zur FDP) sei der "Kampf gegen rechts" das gegenüber den Bürgern propagierte Hauptanliegen, das sie alle eint. Ansonsten hätten die Parteien den Bürgern kaum etwas anzubieten: keine neuen Ideen, Programme und Konzepte.
10.04.2021 17:01:41 [Peds Ansichten]
Arzt zu sein ist eine Berufung
Wer sich dieser Berufung nicht stellt, hat auch nicht das Recht aus der Rolle eines Arztes zu argumentieren.

Mehr noch führt er den Berufsnamen anmaßend vor. Der “Experte in Weiß”, von dem ich spreche, heißt Karl Lauterbach. Dieser Mann ist ein Rattenfänger, einer der die Verängstigten um sich sammelt und diese mit der trügerischen Sicherheit füttert, ihnen den Weg aus dem Elend zeigen zu können. Lauterbach betreibt Drecksarbeit, wobei das nicht einmal der tatsächliche Skandal ist.

Die Zahl der paranoiden Ausbrüche des Karl Lauterbaches sind inzwischen Legion.

10.04.2021 17:06:54 [Tichys Einblick]
Das doppelte Märchen von der Corona-Triage
Der Lockdown war allein zur Verhinderung der Überlastung des Gesundheitssystems geplant, das muss man sich immer wieder vor Augen führen. An der Frage, wie wahrscheinlich dieses immer wieder bemühte Szenario, die „Triage“, tatsächlich ist, entscheidet sich letztendlich auch die Frage nach dem Lockdown. Immer wieder gezeigt werden die Statistiken des DIVI-Intensivregisters, die einen dramatischen Rückgang der freien Intensivbetten offenbaren. Ursache dafür ist aber im Wesentlichen nicht die Zunahme der belegten, sondern der Rückgang der überhaupt einsatzbereiten Intensivbetten insgesamt. Woran das im einzelnen liegt und was das bedeutet, ist eine relativ komplizierte Frage, bei der man es sich mit der bloßen Analyse derartiger Statistiken zu einfach macht.
10.04.2021 18:42:14 [Vera Lengsfeld]
Söder warnt vor Maaßen – wer warnt die Massen vor Söder?
Wer geglaubt hat, dass Merkel der größte anzunehmende Unfall in der Geschichte der Union und Nachkriegsdeutschlands ist, könnte den bayrischen Ministerpräsidenten unterschätzt haben. Der Mann, der mit dem Spruch „Merkel-Stimmen gibt es nur mit Merkel-Politik“ am vergangenen Aschermittwoch Corona-Lockerungen in Aussicht stellte, könnte die Kanzlerin noch übertreffen. Zumindest die Dreistigkeit spricht für sich, mit der er sich nicht um sein Geschwätz von gestern schert, wie seine Statements zur Merkelschen „Osterruhe“ beweisen, die er erst befürwortet, dann aber für einen Fehler erklärt hat.
11.04.2021 06:58:02 [Antikrieg]
Von der Osterruhe zum Sommerkoma
Es ist kein Wunder, dass Bodo Schiffmann für die Betreiber der Covid-Angst-und-Panik-Kampagne als Erzfeind Nummer Eins dasteht. Von Anfang an hat er mit seinen Videos eine intensive Aufklärungsarbeit betrieben, die an Eindeutigkeit und Umfang nichts zu wünschen übrig ließ. Seine Videos fanden große Verbreitung und ließen klar erkennen, dass wir es mit einem politischen Programm zu tun hatten, das hinter einem aufgemascherlten medizinischen Zirkus ablief und in Wirklichkeit auf die Einschränkung von Grund- und Freiheitsrechten abzielte.
11.04.2021 07:10:44 [Opposition 24]
Wie wirksam ist der Widerstand?
Wer hat eigentlich den Spruch der Nichtwähler in Umlauf gebracht, nachdem Wahlen nichts bringen würden, weil sie sonst verboten wären? Kurt Tucholsky, wie oft behauptet, war es jedenfalls nicht. Dafür gibt es keinen einzigen Beleg. Wem bringen solche Kampagnen etwas? Jede nicht abgegebene Stimme nutzt den etablierten Parteien, die selbst bei 99 Prozent Nichtwählern keinerlei Scham zeigen würden, ihre "Mandate" anzutreten.

Gegenfrage: Wenn Wahlen sowieso nichts ändern, warum gibt es dann Wahlfälschung? In Deutschland übrigens keine Seltenheit. Von Einzelfällen kann man ob der Fülle der Skandale wohl kaum sprechen. Was für Wahlen gilt, kann man auch über Demonstrationen sagen.

11.04.2021 07:18:46 [Heise]
Vom Megatrend zum Zukunftsministerium
Der alte Megatrend Computertechnik heißt heute Digitalisierung. Doch selbst das ist steigerungsfähig. Mit dem Z-Ministerium kommt "Deep Tech". Was wie eine lustige Anekdote klingt, hat einen etwas ernsteren Hintergrund: Heute vor zwei Jahren wurde der Wikileaks-Gründer Julian Assange von britischen Ermittlern auf Wunsch von US-amerikanischen Strafverfolgern aus der Botschaft Ecuadors in London geholt und in ein Gefängnis transportiert. Nach britischem Recht gilt bei Auslieferungsverfahren in die USA das Prinzip der Dual Criminality: Ein Straftatbestand muss in beiden Ländern eine Straftat sein.
11.04.2021 09:37:43 [Zettels Raum]
Das Ende der Fahnenstange
Bei der Hintergrundrecherche für einen anderen Artikel, der noch in Arbeit ist, habe ich mich ein wenig intensiver mit dem Thema Inflation beschäftigt. Sie wissen schon, die Inflation, die seit Jahren so vor sich hindümpelt und der EZB permanent als Begründung dient weiters Geld zu drucken. Die selbe Inflation, die "gefühlt" jedes Jahr mehr und mehr steigt und von der uns das statistische Bundesamt im Auftrag der Regierung permanent erklärt, das finde nur in unserem Kopf statt.

­Fangen wir mal ganz plakativ an. Die älteren von uns (okay, die nicht mehr absolut jungen) werden sich noch erinnern, dass wir im Jahr 2002 die DM gegen den Euro tauschten. Vielfach wurden Preise angepasst, doch das statistische Bundesamt erklärte uns der "Teuro" sei nur eine Illusion und eigentlich seien die Preise kaum gestiegen (offiziell um 1,3 Prozent in jenem Jahr).

11.04.2021 09:38:45 [Polit Platsch Quatsch]
Corona-Koma: Ein Bauchladen, der auseinanderfliegt
Jetzt nur noch ganz schnell den Föderalismus schleifen und auch der Bundesrepublik, wie sie die Alliierten wollten und die Gründerväter wollen durften, einen Zentralstaat machen. Seht doch nur, wie gut es in Frankreich läuft! Mit einer Bundesnotbremse für die Laschet-Brücke, aber ohne Corona-Kabinett beginnt das vielleicht schon vorletzte Kapitel des deutschen Pandemie.-Dramas: Die Kanzlerin, geschwächt, aber aufrecht, wenn auch unsichtbar, ist allein auf der Brücke. Unter Deck formieren sich die Meuterer, der ein hier mit seinen Fans, der andere dort. Wüssten sie wirklich guten Rat, müssten sie sofort übernehmen. Doch sie trauen sich selbst nicht, wie auch sie sich selbst nicht mehr traut.
11.04.2021 13:13:38 [Prabels Blog]
Der Impfausweis und die Realität
Die Propagandamaschine der NGOs macht mächtig Dampf für den Impfausweis, der im Gegensatz zu gleichen Rechten für alle Untertanen feudale Privilegien und Freuden verheißt. Eine bürgerliche Alternative wird garnicht mehr diskutiert. Es wird der Eindruck erweckt, als dürfe man ohne Impfung in Zukunft dies und das nicht mehr. Es verlohnt sich, dieses Szenario vorausblickend zu betrachten. Es ist garnicht so schlecht.

Braucht man die Leistungen, die dann mit Ausweis erlangbar sind überhaupt? Und schießt sich der Fiskus nicht selbst ins Knie, wenn er mögliche Konsumenten aus dem Markt oder was davon noch übrig geblieben ist, ausschließt und vertreibt?

11.04.2021 13:15:27 [Polit Platsch Quatsch]
Revolution statt Opposition: Laschet auf den Barrikaden
Es war Unions-Fraktionschef Ralph Brinkhaus, der Ende März den Anfang machte. In einer Brandrede kündigte der einst gegen den Willen der Bundeskanzlerin ins Amt gewählte Mann aus Wiedenbrück in NRW eine Revolution an: Würden sich die Wählerinnenn und Wähler im Herbst entscheiden, CDU und CSU endlich auch mal ans Ruder zu lassen, werde "ganz offen und ehrlich die Wahrheit gesagt", der "Staub von 200 Jahren" weggeblasen und nicht nur eine Reform, sondern wahrscheinlich sogar eine Revolution" im Lande ausbrechen.

Für die einen, vielleicht gerade noch vor dem Ende der aktuellen Koalition auf einen schönen Posten gerückt, eine Horrorvorstellung.

11.04.2021 16:50:39 [ZG Blog]
Verschwörungslegenden
Geheimdienste. Kriminelle Netzwerke. Korrupte Seilschaften. Der »tiefe Staat«. Lobbyismus. Gekaufte Wissenschaft. Der digital-finanzielle Komplex. Bargeldabschaffung. Alles Quatsch! Verschwörungen gibt es nicht und hat es nie gegeben! Das alles gibt es nur in Film und Fernsehen! Wer hier irgendetwas »sehen« will, ist ein Verschwörungserzähler. Ein Spinner. Ein Schwurbler. Ein Aluhut. Denn alles Undenkbare, ist Verschwörungsmythos. Jede abweichende Meinung, tiefergehende Analyse oder alternative Perspektive, die dem allgemeinen Hofbericht-Narrativ widerspricht, muss eine Verschwörungslegende sein. Sie soll und darf nicht analysiert, untersucht oder recherchiert werden.
11.04.2021 16:51:56 [Dushan Wegner]
Was tun, wenn man sich verfahren hat?
Deutschlands Problem ist nicht (nur), dass es sich fürchterlich verfahren hat. Deutschlands Problem ist, dass es ratlos ist und nicht sagen kann, wo es überhaupt hin wollte. Wenn Sie sich verfahren haben, und wenn Sie es erkennen, und wenn Sie diesen Zustand korrigieren möchten, dann wäre es nur natürlich, zunächst zu sagen: »Kein Problem, dann fahren wir halt wieder richtig!«, doch bald stellen Sie fest, dass Ihnen bereits prinzipiell mindestens zwei Arten von Korrektur offenstehen.

Die naheliegendste Art der Korrektur besteht darin, auf den ursprünglich geplanten Weg zurückzukehren. Dies wiederum können Sie angehen, indem Sie die falsch gefahrene Strecke zurückfahren bis eben zum Punkt, an welchem Sie falsch abbogen.

11.04.2021 18:48:55 [Anderwelt Online]
Warum werden wir eine Dauerimpfpflicht kriegen? – Folge dem Geld!
Noch nie wurden so viele Impfdosen in so kurzer Zeit in so vielen Produktionsstätten hergestellt. Noch nie wurden so viele Produktionsstätten für Impfstoffe mit so viel Geld und Subventionen in so kurzer Zeit aus dem Boden gestampft. Was sollte damit geschehen, sollte jemals die Plandemie vorbei sein? Es fühlt an wie ein Naturgesetz, ist aber keines: Ist erst mal ein neues Ministerium, eine neue Abteilung, eine neue Produktionsstätte, ja ein neues Bürokratiemonster geschaffen worden, werden die Bedingungen so verändert, angepasst, dass sie entweder nie mehr verschwinden oder zumindest die Investition rentieren.
11.04.2021 18:50:04 [Unbesorgt]
Beleidigung als Straftatbestand
Zu allen Zeiten gab es Gesetzesänderungen, die bewusst unter dem Radar der veröffentlichen Meinung erfolgen. So wurde etwa die Todesstrafe in der DDR recht stillschweigend im Jahr 1987 abgeschafft, als die SED-Granden verblüfft feststellen mussten, wie Gorbatschows Perestroika in der sowjetischen Provinz kurzen Prozess mit korrupten Viertelfürsten machte. Da passte man das Strafgesetz der DDR besser vorsorglich an, falls man selbst mal etwas Gnade brauchen konnte. Auch im Strafgesetzbuch der Bundesrepublik gab es gerade eben eine Änderung, die ich – vorsichtig ausgedrückt – für bemerkenswert halte.
 International (88)
01.04.2021 09:43:21 [TAZ]
Bolsonaro im Panikmodus
Jair Bolsonaro steht vor einer seiner härtesten Bewährungsproben. Aus Protest gegen Brasiliens rechtsradikalen Präsidenten sind am Dienstag die Oberbefehlshaber der Armee, Marine und Luftwaffe gemeinsam zurückgetreten – ein einmaliger Vorgang in der Geschichte Brasiliens. Die Tageszeitung Folha de São Paulo schrieb von „der größten Krise des Militärs seit 1977“, andere Medien sprachen von einem „politischen Erdbeben“.

Grund für den Rücktritt: Bolsonaro hatte am Montag bekannt gegeben, sechs Minister zu ersetzen, darunter Verteidigungsminister Fernando Azevedo e Silva.

01.04.2021 09:59:06 [Amerika 21]
Brasilien: Bolsonaro bringt Militärspitze gegen sich auf
Präsident Jair Bolsonaro hat ein Viertel seines Kabinetts entlassen. Die Wechsel an der Regierungsspitze sind ein Zugeständnis an die rechte Parlamentsmehrheit. Diese hatte von Bolsonaro einen Strategiewechsel in der Corona-Pandemie gefordert und mit einem Amtsenthebungsverfahren gedroht.

Neben der lange geforderten Entlassung des Außenministers und Verschwörungstheoretikers Ernesto Araújo mussten auch die Spitzen des Justizministeriums, des Kanzleramtes (Casa Civil), des Innenministeriums sowie der Generalstaatsanwaltschaft gehen.

01.04.2021 10:09:11 [RT DE]
Argentinien: Hoffnungsvolle Immunreaktion nach erster Sputnik-V-Dosis erlaubt neue Impfstrategie
Überraschende Untersuchungsergebnisse von Antikörperreaktionen nach der ersten und der zweiten Impfung erlaubten es, die bisherige Strategie zu ändern.

In einer offiziellen Erklärung heißt es, dass man mit der Entscheidung versuche, "so viele Menschen wie möglich mit der ersten Dosis zu impfen, um den Nutzen der Impfung zu maximieren und die Krankenhausaufenthalte und die Sterblichkeit zu verringern".

Russland lieferte bis zum 28. März über fünf Millionen Dosen des Impfstoffs nach Argentinien mit seinen knapp 45 Millionen Einwohnern.

01.04.2021 10:11:42 [NachDenkSeiten]
Tödlicher Beruf
Fast zwei Jahrzehnte nach Beginn der NATO-Besatzung gehört Afghanistan zu den tödlichsten Ländern für Journalisten und Medienschaffende. Verantwortlich hierfür sind auch jene Akteure, die sich meist die Pressefreiheit auf die Fahne schreiben. Eine Reportage von Emran Feroz aus Kabul: Fazelminallah Qazizais schwarzer Toyota ist verstaubt und abgenutzt. Der Wagen fährt, doch einige leichte Schäden sind bemerkbar. „Der muss mal dringend wieder gewartet werden“, bemerkt der 34-jährige Journalist, während er sich durch den anstrengenden Kabuler Verkehr durchschlängelt.
01.04.2021 11:36:13 [Amerika 21]
Chile: Opposition und Regierung einigen sich auf Verschiebung der Wahlen
Die zuständige parlamentarische Kommission in Chile hat ein Gesetzesprojekt verabschiedet, das die Wahlen vom 11. April um fünf Wochen verschiebt. Nun werden diese am 15. und 16. Mai stattfinden. Die Opposition hatte über Stunden gezaudert das Projekt anzunehmen, um begleitende Maßnahmen zu erreichen, die eine Verbesserung der epidemiologischen Lage im Mai garantieren.

Am 28. März bat Präsident Sebastián Piñera das Parlament um ein entsprechendes Gesetz. Trotz Impferfolg sind die Infektionszahlen seit einem Monat rasant gestiegen.

01.04.2021 15:09:40 [Amerika 21]
Venezuela: Zusammenstöße im Grenzgebiet halten an
Aufgrund der Gefechte zwischen der venezolanischen Armee und mutmaßlichen Dissidentengruppen der Farc-EP sind Tausende Venezolaner nach Kolumbien geflüchtet. Während der Auseinandersetzungen im Grenzgebiet zwischen Kolumbien und Venezuela, die seit über einer Woche unvermindert anhalten, soll es auch zu Menschenrechtsverletzungen von Seiten des venezolanischen Militärs gegen die Zivilbevölkerung gekommen sein.

Am 22. März griff die Luftwaffe der Fuerzas Armadas Nacionales Bolivarianas (FANB) Lager von bewaffneten Gruppen an.

01.04.2021 15:12:50 [Buchkomplizen]
Bolsonaro fährt gegen die Wand
Der Rücktritt und der Austausch mehrerer Minister in dieser Woche sind das Ergebnis eines langen Prozesses, der zunächst in der Anhäufung von Generälen und Militärs in Bolsonaros Regierung gipfelte. Nach einer Umfrage der Zeitung Globo sind 6157 aktive und Reserve-Militärs in zivilen Positionen in der Regierung. Hier gibt es keine Posten und Plätze mehr für brasilianische Politiker.

Diese Demonstration politischer Unabhängigkeit, die Bolsonaro der Welt zeigen wollte, hat dazu geführt, dass weder das Parlament noch der Senat mehr Gesetze verabschiedet haben. Er begann mit provisorischen Maßnahmen zu regieren, die ihre Gültigkeit verlieren, wenn sie nicht korrigiert und vom Senat genehmigt werden.

02.04.2021 12:11:03 [Amerika 21]
Jeanine Áñez im Gefängnis: Beweise für den Putsch in Bolivien
Das Foto, das Jeanine Áñez buchstäblich hinter Gittern zeigt und auf dem deutlich die Inschrift "Frauengefängnis" zu sehen ist, ging rasch um die Welt und zeitigte innerhalb und außerhalb Boliviens große Wirkung. Die Ex-de-facto-Präsidentin wurde am 13. März in ihrem Haus in Trinidad, Hauptstadt des Amazonasdepartamentos Beni, festgenommen und sitzt wegen ihrer Verantwortung beim Staatsstreich im November 2019 zunächst für sechs Monate in Untersuchungshaft.

Zwei ihrer ehemaligen Minister (für weitere drei sind Haftbefehle ausgestellt, sie befinden sich aber außer Landes) und sechs ehemalige Militär- und Polizeikommandeure wurden ebenfalls inhaftiert.

02.04.2021 14:30:25 [Der Freitag]
Corona-Impfkampagne in Kuba soll im Juli starten
Während die Fallinzidenz in Kuba auf hohem Niveau verharrt, hat die Erprobung der kubanischen Corona-Impfstoffe Soberana 02 und Abdala jüngst die letzte Phase erreicht.

Bis Ende März haben laut der Parteizeitung Granma sämtliche Teilnehmenden mindestens die erste Dosis im Rahmen der dritten Studienphase erhalten. Auch die Erprobung des Impfstoffs Abdala schreitet voran. Sollte die Evaluierung erfolgreich verlaufen, will das Land seine Impfkampagne mit beiden Wirkstoffen im Juli starten. Im August 2020 wurden auf Kuba die ersten in Lateinamerika entwickelten Corona-Impfstoffkandidaten vorgestellt, im Herbst begannen die ersten Versuchsreihen.

02.04.2021 14:37:56 [SoZ - Sozialistische Zeitung]
Distanzierung und Normalisierung
Das Verhältnis Israels zu den USA und der arabischen Welt ordnet sich neu. Am 23.März (nach Redaktionsschluss) fanden in Israel erneut Wahlen zur Knesset statt, den vierten in kurzer Zeit. Ändert sich durch den Amtsantritt Bidens etwas am Verhältnis Israels zu den USA und den arabischen Staaten? Darüber sprach Cinzia Nachira von der italienischen Palästina-Solidarität mit MICHAEL WARSCHAWSKI, dem langjährigen Leiter des Alternative Information Center (AIC) in Jerusalem.

Was wird sich für Israel mit der neuen Regierung Biden in den USA ändern?

Biden ist nicht weniger proisraelisch eingestellt als die früheren Administrationen, sowohl der Republikaner als auch der Demokraten.

03.04.2021 11:33:22 [WOZ - Die Wochenzeitung]
Kambodscha: Elegant gekleidet gegen das brutale Regime
Mehr als 130 Oppositionelle stehen in Kambodscha in einem Massenprozess vor Gericht. Eine von ihnen ist Rechtsanwältin Theary Seng. Für sie ist klar: Langzeitherrscher Hun Sen fürchtet Proteste wie in Myanmar. Phnom Penh ist im Lockdown. Premierminister Hun Sen will damit die Ausbreitung des Coronavirus stoppen. Dabei ist Kambodscha bisher gut durch die Pandemie gekommen. Offiziell war die Zahl der Infektionen noch Anfang 2021 extrem niedrig. Der erste Todesfall infolge von Covid-19 wurde erst im März dieses Jahres offiziell gemeldet, nachdem im Februar eine grössere Zahl von Infektionen unter chinesischen Geschäftsleuten registriert worden war.
03.04.2021 13:38:12 [Amerika 21]
Guatemala: Gesetzesentwurf für Vergesellschaftung eingebracht
Das "Komitee für bäuerliche Entwicklung" (Comité de Desarrollo Campesino, Codeca) hat ein Gesetzesprojekt für die Vergesellschaftung der öffentlichen Daseinsvorsorge ins Parlament eingebracht. Mit den Gewinnen sollen Infrastrukur-, Forschungs- und Sozialprogramme finanziert werden.

Das Gesetzesentwurf wurde während einer Demonstration von Codeca am 18. Februar öffentlich vorgestellt und jetzt von der Abgeordneten Vicenta Jeronimo der Partei MLP (Bewegung für die Befreiung der Völker) eingebracht. Die MLP wurde von Codeca Ende 2018 offiziell gegründet und nahm 2019 erstmals an den Präsidentschafts- und Parlamentswahlen teil.

03.04.2021 13:43:38 [Le Monde Diplomatique]
Big Pharma in Kampala
Wie Multis aus aller Welt den Aufbau einer selbstständigen Industrie für Medikamente in Afrika verhindern. Die WHO gibt Fake-Alarm. Am 9. April 2020 warnte die Weltgesundheitsorganisation vor gefälschten Chloroquin-Präparaten wie Nirupquine oder Samquine, die in unterschiedlichen Verpackungen in mehreren westafrikanischen Ländern aufgetaucht sind.1 Seit Ausbruch der Coronapandemie hat der Handel mit chloroquinbasierten Malariamitteln, die angeblich gegen das Coronavirus helfen sollen, explo­sions­artig zugenommen. Die Wirksamkeit des vermeintlichen Wundermittels gegen Covid-19 wurde allerdings bislang durch keine einzige wissenschaftliche Studie belegt.
03.04.2021 15:20:41 [Der Freitag]
USA: Obszöne Ungleichheit
Die arbeitende Bevölkerung kämpft sich irgendwie durchs Leben, während es den Reichen nie so gut wie heute ging. Hier schreibt Bernie Sanders, was er dagegen tun will. Die USA können nicht florieren und eine lebendige Demokratie bleiben, wenn so wenige so viel und so viele so wenig haben. Viele meiner Kongress-Kollegen ignorieren das Problem der Einkommens- und Vermögensungleichheit lieber. Dabei ist diese Ungleichheit eine der großen moralischen, wirtschaftlichen und politischen Krisen, mit denen wir konfrontiert sind – und sie muss angegangen werden. Die traurige Realität ist, dass wir uns schnell auf eine oligarchische Gesellschaftsform zubewegen.
03.04.2021 15:22:07 [Amerika 21]
Mexiko: Weiterer Mord an Gegner von Staudammprojekt am Río Verde
Im mexikanischen Bundesstaat Oaxaca ist am 28. März erneut ein Menschenrechtsverteidiger umgebracht worden. Jaime Jiménez Ruiz, ehemaliger Gemeinderat des Dorfes Paso de la Reyna und Mitglied der Bewegung zur Verteidigung des Río Verde, ist damit der fünfte aus seiner Gemeinde der in diesem Jahr getötet worden ist. Er wurde auf offener Straße erschossen.

Die Gemeinde zählt 500 Einwohner und ist landesweit ein Symbol des friedfertigen Widerstands gegen Großprojekte. Gemeinsam mit Bewohnern der umliegenden Dörfer mit indigener, afromexikanischer und mestizischer Bevölkerung wehren sie sich seit Jahren erfolgreich gegen Staudammprojekte am Río Verde und vernetzten sich mit ähnlichen Widerstandsprozessen in Mexiko und Mesoamerika.

03.04.2021 17:17:42 [Amerika 21]
US-Dollars zur Finanzierung der Destabilisierung Nicaraguas im Wahljahr
Das US-Imperium setzt seine Finanzierung von Aktivitäten zur Destabilisierung Nicaraguas fort. Am 12. März präsentierte das Nachrichtenprogramm "Revista Sin Fronteras" von Radio La Primerísima Details zu 22 Projekten, die von der US-Regierung über die National Endowment for Democracy (NED) finanziert werden.

Für diese Projekte, die am 23. Februar dieses Jahres auf der NED-Website veröffentlicht wurden, werden 1,57 Millionen US-Dollar in fünf Bereichen ausgezahlt. Diese Gelder sind für das erste Quartal 2021 vorgesehen.

Jugend, Propaganda und Menschenrechte sind die Schwerpunkte der Finanzierung für die Destabilisierung. Die NED listet die Namen der Empfängerorganisationen inzwischen nicht mehr auf der Website auf.

03.04.2021 18:40:23 [SoZ - Sozialistische Zeitung]
Der Bolsonarismus ist schlagbar
Die vor etwa fünf Jahren gegen Lula da Silva (75), zentrale Persönlichkeit der lateinamerikanischen Linken, gefällten Urteile wegen Vorteilsnahme, Korruption und Geldwäsche wurden am 8.März einzelrichterlich vom Obersten Bundesgericht in Brasília (STF) für nichtig erklärt. Politisch ist die Entscheidung eine Bombe, ein erster großer Sieg gegen den Bolsonarismus und hat weltweit Beachtung gefunden.

Die Entscheidung hat vor allem eins zur Folge: Lula könnte rein rechtlich bei den Präsidentschaftswahlen im kommenden Jahr wieder antreten. Er selbst hat sich dazu noch nicht geäußert, hatte bislang für Fernando Haddad geworben, der kurzfristig bei den letzten Präsidentschaftswahlen für Lula einsprang und immerhin 47 Millionen Stimmen holte.

04.04.2021 06:49:44 [Einartysken]
"Wissenschafts-Leugner" oder Bedrohung für das Imperium?
Während seine COVID-Politik die Medienberichterstattung über sein Verschwinden und seinen verdächtigen Tod dominiert hat, wurde Tansanias John Magufuli von den westlichen Eliten für viel mehr gehasst als für seine Ablehnung von Abriegelungen und Maskenmandaten. Insbesondere seine Bemühungen um die Verstaatlichung des Mineralienreichtums des Landes drohten, dem Westen die Kontrolle über die Ressourcen zu entziehen, die als essentiell für die neue grüne Wirtschaft gelten.

Vor weniger als zwei Wochen meldete die tansanische Vizepräsidentin Samia Suluhu Hassan die Nachricht, dass der Präsident ihres Landes, John Pombe Magufuli, an Herzversagen gestorben sei.

04.04.2021 09:35:22 [Amerika 21]
Völkertribunal zu Kolumbien hat getagt
Zum dritten Mal hat das Permanente Völkertribunal (Tribunal Permanente de los Pueblos, TPP) in Kolumbien stattgefunden. Das TPP ist eines der von Regierungen unabhängigen internationalen Gerichte, die nach dem Zweiten Weltkrieg gegründet worden sind. Es hat zum Ziel, Menschenrechtsverletzungen, die von den Staaten ignoriert worden sind, zu untersuchen, zu visibilisieren und vor Gericht zu bringen.

Vom 25. - 27. März haben Basisorganisationen, Gewerkschaften und opositionellen Parteien anlässich der 48. Session des TPP’s über zahlreiche Fälle von schwerwiegenden Menschenrechtsverletzungen berichtet.

04.04.2021 09:45:08 [RT DE]
Floridas Gouverneur verhindert Impfpässe
Eine Verordnung, die der republikanische Gouverneur Floridas Ron DeSantis am Freitag unterzeichnete, stellt fest, dass COVID-19-Impfpässe nicht gesetzlich vorgeschrieben sind und Datensätze über individuelle Impfungen private Gesundheitsinformationen sind. Die Forderung nach Impfpässen für den Zugang zu Waren, Dienstleistungen oder Aktivitäten würde die individuelle Freiheit verletzen und in die Privatsphäre eindringen, heißt es weiter. Es sei keinem Geschäft oder staatlicher Stelle erlaubt, von den Menschen in Florida zu verlangen, Dokumente zu ihrem Impfstatus vorzulegen.
04.04.2021 09:54:44 [Linke Zeitung]
Bidens große Strategie ist wahnhaft und gefährlich
Die Biden-Administration fährt fort, ihre wahnhafte und gefährliche große Strategie voranzutreiben, die nicht einmal den eigenen Interessen der USA dient, sondern nur den kurzfristigen engen Interessen eines bestimmten Segments ihrer wirtschaftlichen und politischen Elite.

Die große Strategie von US-Präsident Joe Biden ist eine Mischung aus demokratischer Wertsignalgebung und republikanischer Aggression, was eine wahnhafte und gefährliche Kombination darstellt. Die erste Beobachtung wird durch die Betonung sogenannter „Demokratie“- und „Menschenrechts“-Ideale durch seine Administration belegt, die sich in ihren Informationskriegskampagnen gegen China und Russland auf diesen falschen Grundlagen manifestiert.

04.04.2021 11:35:10 [Amerika 21]
Kuba weist Bericht des US-Außenministeriums als verleumderisch zurück
Kubas Präsident Miguel Diaz-Canel hat einen am Mittwoch veröffentlichten Report des US-Außenministeriums über die Menschenrechtslage auf der Insel als "unwürdige, unmoralische und lügnerische Anschuldigung" bezeichnet.

Die Abteilung für Demokratie, Menschenrechte und Arbeit des U.S. State Department hatte darin von Fällen "außergerichtlicher Tötungen" und "Folter" in Kuba geschrieben. Dafür zitierte es den Fall des im vergangenen Sommer von der Polizei erschossenen mutmaßlichen Räubers Hansel Hernández, dessen genaue Todesumstände derzeit noch von den Behörden untersucht werden.

04.04.2021 13:07:21 [Junge Welt]
Ein politisches Manöver
Die eigentlich für das kommende Wochenende in Chile geplanten Wahlen werden verschoben. Wenige Tage vor dem ursprünglichen Abstimmungstermin nahm das Abgeordnetenhaus am Mittwoch (Ortszeit) einen entsprechenden Antrag des rechten Präsidenten Sebastián Piñera an. Statt am 10. und 11. April werden nun am 15. und 16. Mai die Spitzen von Gemeinden und Regionen sowie die Abgeordneten des Verfassungskonvents gewählt. Die Mitglieder des Konvents sollen eine neue Verfassung ausarbeiten, nachdem sich am 25. Oktober 2020 eine überwältigende Mehrheit der Wähler in einem Referendum für die Ablösung der alten, noch aus der Diktatur stammenden ausgesprochen hatte.
04.04.2021 13:14:02 [Amerika 21]
Venezuela und Russland verstärken Wirtschaftsbeziehungen
Venezuela und Russland haben weitere Verträge zur Zusammenarbeit in den Bereichen Energie, Handel, Finanzen, Transport, Militär, Landwirtschaft und Arzneimittel unterzeichnet. Die Handelsabkommen, die Teil eines Zehnjahresplans sind, waren das Ergebnis von fünf Treffen, die in Caracas im Rahmen der Hochrangigen zwischenstaatlichen Kommission (Comisión Intergubernamental de Alto Nivel, Cian) stattfanden.

Russlands Vizepremierminister Juri Borissow, der die Kreml-Delegation leitete, traf sich mit Präsident Nicolás Maduro, Vizepräsident Delcy Rodríguez und Erdölminister Tareck El Aissami.

04.04.2021 13:22:59 [Kai Ehlers]
Herausforderung China – dem Zeitgeist auf der Spur
China, Russland und der Westen. Was folgt aus dieser Konstellation, wenn China die Entwicklung seines „Sozialismus mit chinesischem Gesicht“ mit dem Rückgriff auf seine traditionelle Kultur verbindet und sich in dieser Weise in das Weltgeschehen einbringt? Bleibt dieser Impuls auf China beschränkt oder wirkt er als Herausforderung an die übrige Welt, sich in den Zeiten des „Großen Umbruchs“ in gleicher Weise auf ihre Traditionen zu besinnen?

Und welchen Charakter könnte diese Besinnung tragen? Hieße Rückbesinnung nur, die westlichen „Werte“, die in den letzten Jahrhunderten das Weltgeschehen bestimmt haben, gegen die chinesische, die asiatische Herausforderung zu behaupten?

04.04.2021 15:20:39 [Der Freitag]
Kein Impfstoff für die Palästinenser
Das Coronavirus hat nicht vor dem von Israel besetzten Westjordanland und dem Gazastreifen Halt gemacht. In der Westbank wurden schon Anfang Februar etwa 115.000 Infektionen gezählt, Tendenz steigend – etwa 1.400 Tote waren bis dahin zu beklagen. Die Angaben für den Gazastreifen mit 2.471.000 Einwohnern lagen Ende Februar bei 56.500 Infektionen und 560 Toten bis dahin. Während sich Israel dafür feiern lässt, die höchste Impfrate weltweit vorweisen zu können, kämpfen die Palästinenser darum, wenigstens einige Dosen Vakzin egal welches Herstellers für das medizinische Personal zu erhalten.
04.04.2021 19:01:56 [Amerika 21]
Trump, Biden und die "heiße Kartoffel" der Dieselknappheit in Venezuela
Wird US-Präsident Biden die Diesel-Sanktionen aufheben? Auch regierungskritische NGOs und Vertreter der Opposition warnen vor deren Folgen. Diese Kolumne will nicht sensationslüstern sein oder die Situation vor Ort in Venezuela übertreiben. Hier zu leben und mit den täglichen Problemen konfrontiert zu sein, erfordert es, verantwortungsbewusst zu sein, um angemessen in die Debatte über die aktuelle Krise einzugreifen und unsere Analyse nicht auf parteiische Standpunkte zu reduzieren, die von den Kräften in dem Konflikt eingenommen werden.

Die jüngste Dieselknappheit zwingt uns jedoch dazu, bei denjenigen, die sich weltweit solidarisch zeigen, Alarm zu schlagen.

05.04.2021 09:58:47 [RT DE]
Im Schlaglicht: Joe Biden, der Visionär
Joe Biden ist 78 Jahre alt und unterschreibt ein Achtjahresprogramm. Das klingt, als würde man einem fast Achtzigjährigen eine Lebensversicherung verkaufen. Ablauf ungewiss. Man möchte ja niemandem etwas Böses. Doch Ambitionen sind eines, deren Umsetzung etwas anderes. Doch lassen wir ihm seine Visionen. Ex-Kanzler Helmut Schmidt sagte einmal: "Wer Visionen hat, sollte zum Arzt gehen." Vielleicht war Biden da schon. Es wird schon einen Grund haben, warum sich in der Vergangenheit nie einer an die Reaktivierung der berüchtigten Infrastrukturschwäche der USA gewagt hatte. Nicht einmal der Gewaltbekämpfer Rudi Giuliani hatte als New Yorker Bürgermeister seine Schlaglöcher im Griff.
05.04.2021 12:05:02 [Amerika 21]
Seris-Indigene in Mexiko seit Monaten ohne Wasser
Seris-Indigene im nordmexikanischen Bundesstaat Sonora haben mit einem Fußmarsch gegen Wassermangel sowie gegen die überteuerten Stromtarife in ihren Gemeinden protestiert. Mit dem "Caminata Comcáac" wollten sie Aufmerksamkeit für die langjährige Problematik erregen. In den Gemeinden Comcáac, El Desemboque, Punta Chueca und El Piquito funktioniert die Wasserversorgung seit Dezember 2020 nicht.

Die Protestierenden haben nach eigenen Angaben alle notwendigen bürokratischen Schritte unternommen, dennoch komme die Regierung ihrer Verpflichtung nicht nach.

05.04.2021 14:03:28 [Amerika 21]
Armut in Argentinien steigt dramatisch
In Argentinien leben derzeit rund 42 Prozent der Bevölkerung in Armut. Mehr als zehn Prozent sind von extremer Armut betroffen. Diese Zahlen gehen aus dem kürzlich veröffentlichten Armutsbericht des staatlichen Statistikinstituts Indec für das zweite Halbjahr 2020 hervor.

Untersucht wurden landesweit 31 städtische Ballungsräume mit insgesamt knapp 29 Millionen Einwohnern. Hochgerechnet auf die Gesamtbevölkerung von rund 46 Millionen Menschen ergibt dies eine Gesamtzahl von mehr als 19 Millionen, die in Armut, und rund 4,5 Millionen, die in extremer Armut leben.

05.04.2021 15:44:59 [Der Freitag]
Australien: Bastion der Machos
Justizminister Porter wird Vergewaltigung vorgeworfen. Das ist kein Einzelfall. Ein Thema wird einmal mehr zum Spielball zwischen Regierung, Justiz und Medien. Im Jahr nach dem spektakulären Prozess gegen Kardinal George Pell, den höchsten Vertreter des katholischen Klerus in Australien, der in dubio pro reo endete, wird nun einem prominenten Politiker vorgeworfen, der Vergewaltigung schuldig zu sein. Eine nicht eben seltene Straftat in Down Under, zu der es in Australien pro Einwohner fast viermal häufiger kommt als beispielsweise in Deutschland. Mit erstickter Stimme musste Justizminister und Generalstaatsanwalt Christian Porter bei einer Pressekonferenz einräumen, ein Beschuldigter zu sein.
05.04.2021 16:01:21 [Neues Deutschland]
Chile: Impfen schützt vor Lockdown nicht
»Wir befürchten, bald überfordert zu sein, nicht mehr alle Menschen medizinisch versorgen zu können.« Die Aussage von Izkia Siches lässt in Chile die Alarmglocke läuten. Die Präsidentin der Ärztekammer machte im staatlichen Fernsehsender TVN auf die aktuelle Entwicklung der Corona-Pandemie aufmerksam. Derzeit sind so viele Menschen wie noch nie in Krankenhäuser eingewiesen. Die Belegung liegt bei 97 Prozent und die Welle wächst unentwegt. In Chile ist die zweite Welle voll im Gange. 5000 Neuinfektionen kommen derzeit täglich in dem südamerikanischen Land dazu, das knapp 20 Millionen Einwohner zählt.
05.04.2021 17:11:01 [Qantara]
Femizide in Algerien: Das Patriarchat schlägt zurück
Zwar hat Algerien Gesetze, die Frauen gegen Gewalt schützen sollen, doch sie helfen den Frauen nicht. In jüngster Zeit ist die Zahl der Femizide gestiegen und treibt hunderte von Frauen dazu, sich über die Corona-Beschränkungen hinwegzusetzen und auf der Straße zu protestieren. Am 26. Januar wurde die algerische Journalistin Tinhinane Laceb von ihrem Ehemann ermordet. Laceb war beim öffentlich-rechtlichen Sender TV4 Tamazight beschäftigt. Am 24. Januar, also nur zwei Tage zuvor, erlitt Warda Hafedh das gleiche Schicksal. Die 45-Jährige war Mutter von fünf Kindern. Ihr Ehemann schlug ihr dreimal mit einem Hammer auf den Kopf und stach ihr fünfmal ins Herz. Die Bluttat fand vor den Augen ihrer sechs Jahre alten Tochter statt.
06.04.2021 06:51:23 [Tichys Einblick]
Biden beginnt erste Schritte für Rückkehr zum Iran-Deal
Wie das "Wall Street Journal" am Freitag berichtete, wird die US-Regierung unter Präsident Biden nächste Woche in Wien indirekte Verhandlungen mit dem iranischen Regime über den Atom-Deal beginnen. Mit dabei sind wohl auch wieder Deutschland, Frankreich, die EU, Großbritannien, Russland und China.

US-Präsident Trump veranlasste 2018 den Austritt Amerikas aus dem 3 Jahre zuvor geschlossenen Deal. Dem zuvorgegangen waren u.a. von Israels Premierminister Netanyahu präsentierte Beweise, dass der Iran die Auflagen von Anfang an systematisch unterlief. Der Austritt aus dem Iran-Deal war allerdings schon vorher ein Wahlkampfversprechen Trumps gewesen.

06.04.2021 09:22:36 [Amerika 21]
EU will zwischen USA und Kuba vermitteln
Die Europäische Union (EU) hat sich bereit erklärt, in den Beziehungen zwischen Kuba und den USA zu vermitteln. Der Hohe Vertreter der EU für Außen- und Sicherheitspolitik und Vizepräsident der Europäischen Kommission, Josep Borrell, erklärte, er wolle gegenüber der US-Regierung vermitteln, um "Kuba von der einseitigen Liste der Länder zu streichen, die den Terrorismus fördern". Er werde in Gesprächen mit der Regierung von US-Präsident Joe Biden "dieses Thema ansprechen und die USA auffordern, diese Einordnung aufzuheben."

Als Reaktion auf Borrells Bereitschaft twitterte Ana Mari Machado, stellvertretende Präsidentin der kubanischen Nationalversammlung, dass sie diese Entscheidung der EU begrüße.

06.04.2021 09:27:58 [Junge Welt]
Wahl in Peru: Ohne Favoriten
Inmitten der immer dramatischer werdenden Gesundheitskrise in der zweiten Welle der Coronapandemie sind in Peru am kommenden Sonntag 25 Millionen Wahlberechtigte dazu aufgerufen, einen neuen Präsidenten, dessen Stellvertreter sowie 130 Kongressabgeordnete neu zu bestimmen. Anders als der südliche Nachbar Chile hält die Andenrepublik an dem Wahltermin fest. Hintergrund dürfte unter anderem die Hoffnung sein, so einen Weg aus der anhaltenden politischen Krise zu finden.

Seit 2016 erschüttern zahlreiche Korruptionsskandale das Land – mit weitgehenden Konsequenzen für die Politik. In den vergangenen fünf Jahren bekleideten fünf Personen das Präsidentenamt, keine von ihnen beendete ihr Mandat.

06.04.2021 11:23:04 [RT DE]
Pünktlich zu neuen Verhandlungen warnen "westliche Geheimdienste" vor iranischen Atom-U-Booten
Unter Berufung auf mutmaßliche Informationen "westlicher Geheimdienste" berichtete die Welt kürzlich, dass Iran seine Bemühungen um die Entwicklung von Atom-U-Booten in der letzten Zeit "erheblich" vorangetrieben habe. Das Springer-Blatt zitiert den Oberbefehlshaber der iranischen Marine, Hossein Khansadi, der im April vergangenen Jahres gegenüber iranischen Nachrichtenagenturen offiziell erklärte, "die Entwicklung nuklear angetriebener U-Boote steht klar auf der Agenda der Marine der Streitkräfte der Islamischen Republik Iran".

Nach Wahrnehmung der Zeitung hat sich der Konteradmiral dabei "verplappert".

06.04.2021 11:31:45 [Amerika 21]
Aktivistin der indigenen Wayuu-Gemeinschaft in Kolumbien getötet
In der Nacht vom 31. März ist eine Aktivistin vom indigenen Volk der Wayuu in der Gemeinde Uribia im Departamento La Guajira ermordet worden. Aura Esther García Peñalver hatte seit dem 15. März Todesdrohungen erhalten. Ihre Anfrage auf Schutzmaßnahmen wurde nicht beachtet.

Die Nationale Indigenenorgansiation Kolumbiens (Onic) hat in einem Kommuniqué ihren Tod bestätigt. Die Frau wurde demnach auf dem Nachhauseweg mit ihrem Ehemann von zwei Unbekannten mit mehreren Schüssen getötet.

06.04.2021 11:35:25 [Neue Zürcher Zeitung]
«Die Mordserie an Asiatinnen hat mich nicht überrascht»
Der amerikanische Anwalt und Aktivist Andy Kang blickt auf eine lange Geschichte von Rassismus gegen die «Schlitzaugen» in den USA zurück. Covid-19 und Trumps fremdenfeindliche Äusserungen haben die Situation verschärft. Am 16. März sind in der Umgebung von Atlanta acht Personen in drei Massagesalons erschossen worden. Sechs von ihnen waren asiatischstämmige Amerikanerinnen, die dort arbeiteten. Offenbar handelte es sich beim Täter um einen Mann, der in den Salons regelmässig sexuelle Dienstleistungen in Anspruch genommen hatte und von einem schlechten Gewissen geplagt wurde. Die Frauen stellten für ihn eine Versuchung dar, die es zu eliminieren galt.
06.04.2021 12:44:45 [Antikrieg]
Warum drängt die Biden-Administration die Ukraine, Russland anzugreifen?
Am 24. März unterzeichnete der ukrainische Präsident Vladimir Zelensky, was im Wesentlichen eine Kriegserklärung an Russland war. In dem Dokument mit dem Titel Präsidialdekret Nr. 117/2021 erklärte der von den Vereinigten Staaten von Amerika unterstützte ukrainische Führer, dass es die offizielle Politik der Ukraine sei, die Krim von Russland zurückzuholen.

Die Erklärung, dass die Ukraine die Krim von Russland zurückholen würde, folgte auch der, und wurde vielleicht von Präsident Bidens aufrührerischer und dummer Aussage angestiftet, dass "die Krim zur Ukraine gehört."

06.04.2021 13:03:33 [RT DE]
Bidens Anti-China-Kampagne zieht nicht
Schon seit der Präsidentschaft Barack Obamas versuchen die USA, im Pazifik einen Ring von befreundeten Staaten gegen den Aufstieg Chinas zu errichten. Doch Washington fällt es immer schwerer, seine Alliierten auf Linie zu halten. Der hochrangige Austausch und die positiven Töne zeigen, dass Washingtons Bemühungen, einen Keil zwischen China und den ostasiatischen Staaten zu treiben, nicht auf fruchtbaren Boden fallen. Südkorea gilt traditionell als sehr enger US-Verbündeter. In dem ostasiatischen Staat, der sich offiziell immer noch im Kriegszustand mit seinem nördlichen Nachbarn befindet, sind weit über 20.000 US-amerikanische Soldaten stationiert.
06.04.2021 16:48:31 [Amerika 21]
Brasilien: Ex-Präsident Lula kündigt Kandidatur für 2022 an
Nachdem der Oberste Gerichtshof seine Haftstrafe aufgehoben hat, will der frühere brasilianische Staatschef Lula da Silva für die Präsidentschaftswahlen im Jahr 2022 erneut kandidieren. "Wenn ich gesund bleibe und es nötig ist, meine Aufgabe zu erfüllen, könnt ihr sicher sein, dass ich in den Ring steige", sagte Lula da Silva dem portugiesischen Fernsehsender RTP.

Dabei stellte er aber auch klar, dass die Kandidatur keine Priorität für ihn habe. Er wolle das Jahr 2022 abwarten und das politische Panorama sehen, das sich bis dahin entwickle. Eines sei für den Ex-Präsidenten sicher: "Der amtierende Staatschef Jair Bolsonaro darf nicht länger Brasilien regieren."

07.04.2021 06:41:52 [Mosaik]
Patagonien: Indigener Widerstand gegen Politik der verbrannten Erde
Vorsätzlich gelegte Brände verwüsten ein Gebiet in Patagonien, in dem sich indigene Gemeinden gegen Landspekulation und den räuberischen Vormarsch der Rohstoffindustrie wehren. Patagonien brennt. Am 10. März brachen innerhalb von nur zwei Stunden sechs Brände im Abstand von wenigen Kilometern in der Comarca Andina aus – einer argentinischen Region in den Anden unweit von Chile. Aufgrund starker Winde, anhaltender Trockenheit, staatlicher Inkompetenz und hochentzündlicher Kieferplantagen, die die Region überziehen, breiten sich die Feuer rasant aus. Tausende Menschen, vor allem Kleinbäuer und Landarbeiter, haben ihre Häuser, Arbeitsplätze, Tiere und Felder verloren. Viele werden vermisst, zwei Menschen sind bereits gestorben.
07.04.2021 06:54:06 [Telepolis]
Europas Wind und Chinas Sturm
Pekings neuer Umgang mit westlichen Sanktionen. Am Montag hätte er keine Zeit, erklärte der chinesische Botschafter in Paris, Lu Shaye, nachdem ihn das Ministère de l'Europe et des Affaires étrangères just für diesen Tag einbestellt hatte. Und das, obwohl umgekehrt der EU-Botschafter in Peking mitten in der Nacht ins Außenministerium zitiert worden war. Erst am Dienstag begab Lu sich dann an den Quai d’Orsay, um "bei der französischen Seite wegen der Sanktionen der EU" gegen China vorstellig zu werden. Diese im diplomatischen Verkehr ungewöhnliche Demonstration von Selbstbewusstsein signalisiert einen neuen Umgang Chinas mit der Sanktionspolitik des Westens.
07.04.2021 11:22:16 [Der Freitag]
Kurznachrichten Libyen – 06.04.2021
Laut der Polizei von Zuwara (Nordwesten von Libyen) wurde ihr Chef, Brigadegeneral Emad ad-Din Masoud Abaza, im Morgengrauen entführt. Dagegen sagte die Generalstaatsanwaltschaft in Tripolis, es habe sich um die Verhaftung des Polizeichefs gehandelt. Das Innenministerium hat sich bisher nicht geäußert.
Inzwischen hat die Polizei von Zuwara aus Protest gegen die Entführung/Verhaftung ihres Chefs den libysch-tunesischen Grenzübergang Ras Adschdir mit Sandwällen blockiert. Sie scheint auch verantwortlich für einen Angriff auf den von der italienischen ENI betriebene Mellitah-Öl- und Gaskomplex in Sabrata, dessen Angestellte evakuiert wurden.

07.04.2021 13:08:53 [Tichys Einblick]
Die Rolle Chinas gegenüber den Militärmachthabern in Burma
Die Volksrepublik China spielt eine Schlüsselrolle im Konflikt zwischen der Putschisten-Regierung in Burma und der protestierenden Bevölkerung. An einem militärischen Eingreifen zugunsten der Militärs dürfte Peking aber kein Interesse haben. Die Volksrepublik China (VRC) ist wichtigster Investor in Burma. Peking steht vor einem Problem: Es befürwortet vom Prinzip her den Staatsstreich der Militärregierung „State Administration Council“ (SAC), auch wenn es dessen unmittelbare Notwendigkeit nicht erkennen konnte. Sollte dieser Staatsstreich jedoch scheitern, wird sich das Volk aufgrund der Nähe zwischen SAC und VRC gegen China wenden. Greift China militärisch ein, wäre das nicht nur ein Eklat für die Beziehungen zu den USA und der EU, sondern könnte zu einem Guerillakrieg der Burmesen gegen China führen.
07.04.2021 14:47:54 [Amerika 21]
Zwei Linke in Peru mit Chancen auf die Präsidentschaft
Eine Woche vor den Präsidentschwaftswahlen in Peru ist laut jüngsten Umfragen noch alles offen. Sieben Kandidaten liegen nur wenige Prozentpunkte auseinander und haben demnach Chancen, in die Stichwahl einzuziehen. Unter ihnen befindet sich die progressive Kandidatin Verónika Mendoza (Juntos por el Perú/Gemeinsam für Peru, JP), aber auch der Sozialist Pedro Castillo (Perú Libre/Freies Peru, PL).

Je nach Umfrageinstitut lagen am Wochenende die Favoriten in verschiedenen Reihenfolgen mehr oder weniger gleichauf.

07.04.2021 16:13:34 [Junge Welt]
Regierungsbildung in Israel: Dauerpremier soll es richten
Israels Präsident Reuven Rivlin hat am Dienstag den seit 2009 ununterbrochen amtierenden Premierminister Benjamin Netanjahu mit der Bildung einer neuen Regierung beauftragt. Ob ihm das gelingt, ist aber zweifelhaft. Das Land ist seit Dezember 2018 ohne eine stabile Regierungsmehrheit. Am 23. März hatten zum vierten Mal innerhalb von knapp zwei Jahren Neuwahlen stattgefunden. Sie bestätigten zwar Netanjahus rechte Partei Likud als stärkste Parlamentsfraktion, brachten aber weder für den Amtsinhaber noch für Oppositionsführer Jair Lapid von der Zentrumspartei Jesch Atid die unmittelbare Aussicht auf eine von ihnen geführte Koalition, die von mindestens 61 der 120 Abgeordneten unterstützt werden müsste.
07.04.2021 16:17:25 [Amerika 21]
Die Demokratien in Lateinamerika unter Belagerung
Die Alarmglocken begannen zu läuten, als die stellvertretende Generalstaatsanwältin Kolumbiens mit Aussagen gegen Andrés Arauz im Gepäck nach Quito kam. Krisensituation, Analyse des Szenarios und – schließlich – eine ruhige und kalte Nacht. Es war eine erneute Bedrohung während der Präsidentschaftskampagne, die vom ersten Moment an von Machenschaften gegen die Kandidatur desjenigen bestimmt ist, der in den Palacio de Carondelet einziehen will, um das Projekt der Bürgerrevolution wieder aufzunehmen.

Das Bild ähnelt den Wahlen in Bolivien 2020, als Luis Arce gewann.

07.04.2021 18:36:05 [Einartysken]
Dörfer im Himalaya stehen vor zunehmenden Trinkwasser-Problemen
Obwohl so viele mächtige Flüsse den Himalaya durchfließen die das Wasser in die großen Ebenen tragen, ist es eine Tatsache, dass viele Himalaya-Dörfer zunehmende und akute Wasserprobleme haben. Im allgemeinen werden diese akuter in der Sommerzeit, so begannen in diesem JahrWassermange schon viel früher aufzutreten, wie aus Himachal Pradesh berichtet wird, was einen neuen Trend ankündigt. Ein kurzer durch die Zeitungsberichte in Himachal Pradesh im März enthüllte vieler solch deprimierender Nachrichten.

Ein wichtiger Aspekt in mehreren dieser Berichte ist, dass sie aus den Dörfern kommemn, wo offenbar Investitionen in Wasserleitungen und Zapfstellen gemacht wurden, um das Wasser näher an die Dörfer heranzubringen.

08.04.2021 07:06:59 [Deutschlandfunk Kultur]
Brasilien und Corona: Atemnot am Amazonas
Covid-19 hat das Amazonas-Gebiet zum zweiten Mal mit voller Wucht getroffen. Im Januar erstickten dort Menschen aus Sauerstoffmangel. Die Krankenhäuser sind völlig überlastet. Präsident Bolsonaro erklärt sich für nicht zuständig.

„Sauerstoff, wir wollen Sauerstoff!“ Wütende Angehörige von Corona-Patienten demonstrierten Mitte Januar vor dem größten Krankenhaus von Manaus. In der Metropole mitten im Amazonasgebiet war die Zahl schwer Kranker in kurzer Zeit regelrecht explodiert. In Manaus gab es nicht einmal mehr genügend Sauerstoff, um alle Patienten zu versorgen, viele erstickten.

08.04.2021 09:36:50 [Amerika 21]
Neue Belege für Beteiligung von Brasilien am Sturz von Allende in Chile
Eine Veröffentlichung des National Security Archive (NSA), einem Zusammenschluss von Investigativ-Journalisten und Wissenschaftler mit Sitz in Washington, hat Verstrickungen Brasiliens in den Staatsstreich von Augusto Pinochet 1973 in Chile bestätigt. Die kürzlich entklassifizierten Dokumente belegen, wie Brasilien unter den Militärregierungen von Emílio Garrastazu Médici (1969-1974) und Ernesto Geisel (1974-1979) mit rechten Kräften in der Region zusammengearbeitet hat, um die sozialistische Regierung Allendes zu stürzen.
08.04.2021 09:38:06 [Buchkomplizen]
Argentinien vor der zweiten Welle: Regierung hat keinen Plan
Über Ostern waren die argentinischen Strände voll, aber nach Monaten der Entspannung fürchten jetzt Restaurants, Theater und Einzelhandel erneute Verbote. Aus allen Kanälen schallen Warnungen vor der „zweiten Welle“, Horrorszenarien werden an die Wand gemalt. Während im Nachbarland Chile geimpft wird, was das Zeug hält (mit zweifelhaftem Erfolg, da die Infektionszahlen trotzdem steigen), fehlt in Argentinien Impfstoff. Die Regierung hat keinen Plan, weder einen guten noch einen schlechten.

Und nun erkrankte Präsident Alberto Fernández an Covid 19 – obwohl ihm bereits vor Wochen zwei Mal Sputnik V gespritzt worden war.

08.04.2021 09:41:56 [RT DE]
Jordanien und das Komplott
Ein mögliches Komplott um einen Halbbruder von König Abdullah II. von Jordanien fügt sich in eine lange Reihe von Familienzwisten. Am 11. April feiert das Königreich sein hundertjähriges Staatsjubiläum. Der Spruch "Totgesagte leben länger" trifft auf die haschemitische Herrscherfamilie zu. Als jordanischer Monarch muss man ein Überlebenskünstler sein. Aus gutem Grund wurde der von 1952 bis 1999 regierende charismatische König Hussein bin Talal "Der Löwe von Jordanien" genannt. Den ersten Anschlag überlebte er dank eines Ordens, den ihm sein Großvater kurz vor dem Attentatsversuch an die Uniform geheftet hatte. Die Kugel prallte am Metall ab. Dutzende weitere Attentatsversuche folgten.
08.04.2021 11:16:35 [Amerika 21]
Corona in Brasilien: Tödlichster Monat und kein Platz mehr für Leichen in São Paulo
Am Dienstag sind in Brasilien innerhalb von 24 Stunden mindestens 4.195 Menschen infolge einer Covid-19-Infektion verstorben. Dies ist ein neuer Höchstwert seit Beginn der Pandemie. Seit nunmehr elf Tagen in Folge liegt der Durchschnittswert der täglich an und mit dem Coronavirus Verstorbenen über 2.500 Menschen. Knapp zehn Prozent der Bevölkerung erhielten inwischen ihre Erstimpfung, knapp drei Prozent ihre zweite Dosis.

Der März war der tödlichste Monat seit Beginn der Pandemie. Vor allem in São Paulo stieg die Zahl der Toten in den letzten Tagen rasant an. Nicht nur die Krankenhäuser sind überlastet, sondern auch die Bestattungsunternehmen.

08.04.2021 13:09:25 [Amerika 21]
Mord an Berta Cáceres: Mutmaßlicher Auftraggeber in Honduras vor Gericht
Fünf Jahre nachdem die honduranische Aktivistin Berta Cáceres von einem Killerkommando in ihrem Haus erschossen wurde, muss sich nun ein mutmaßlicher Auftraggeber vor Gericht verantworten. Am Dienstag begann der Prozess gegen den Direktor des Unternehmens Desarrollos Energéticos (DESA), Roberto David Castillo Mejía, mit über dreistündiger Verspätung und einem Affront: Cáceres Angehörige und mehrere internationale Beobachtungsmissionen wurden aus dem Saal verwiesen. Sie konnten die Verhandlung nach Beschwerden über die schlechte Qualität der öffentlichen Übertragung schließlich nur in einem für sie eingerichteten virtuellen Konferenzraum verfolgen.
08.04.2021 14:47:53 [Einartysken]
Ölgiganten zertrampeln die Rechte der Indigenen
Heute ist ein tragischer Jahrestag am Amazonas in Ecuador. Am 7. April vor einem Jahr, auf dem Gipfel der Pandemie, gab es einen massiven Ölaustritt im Indigenen Territorium im Oberlauf von Napo- und Coca-Fluss mit seinem enormen Bio-Reichtum. Dreihundert und fünfundsechzig Tage sind verflossen, aber das Kichwa-Volk mit 27 000 Menschen hat immer noch keinen Zugang zu sicherem Wasser & Nahrung und es besteht das Risiko neuer Pipeline-Brüche.

08.04.2021 14:53:42 [Junge Welt]
Palästina: Zerstrittene Lager
Die palästinensische Zentrale Wahlkommission hat alle 36 registrierten Listen, darunter sieben Parteien, für die Parlamentswahl am 22. Mai zugelassen. Das teilte das Gremium am Dienstag auf seiner Homepage mit. Die Fatah von Präsident Mahmud Abbas sieht sich gleich zwei Listen gegenüber, die von Fatah-Dissidenten angeführt werden.

Die größten Sorgen dürfte der Fatah die Liste »Freiheit« (Hurriya) von Nassir Al-Kidwa bereiten, die von Marwan Barghuthi unterstützt wird. Abbas hatte bis zum Schluss vergeblich versucht, beide davon abzuhalten, gegen die offizielle Fatah-Liste anzutreten.

08.04.2021 16:58:53 [Junge Welt]
Kolumbien und Venezuela: Spannungen verschärft
Auch mehr als zwei Wochen nach Beginn der Militäroperation »Bolivarisches Schutzschild« gehen die venezolanischen Streitkräfte weiter gegen bewaffnete Gruppen im Bundesstaat Apure an der Grenze zu Kolumbien vor. Laut Informationen der Regierung in Caracas starben dabei bis Montag neun »Terroristen«, 33 wurden festgenommen. Auch venezolanische Soldaten kamen zu Schaden. Am Dienstag (Ortszeit) erklärte der venezolanische Außenminister Jorge Arreaza gegenüber der Presse, die Streitkräfte des Landes hätten die Kontrolle über die Ortschaft La Victoria – Zentrum der Kämpfe – mittlerweile wiedererlangt.
09.04.2021 06:34:48 [TAZ]
Gesundheitsversorgung in Sierra Leone: Wo Corona die Kinder umbringt
Magdalene Fornah hat Ebola überstanden. Nun kämpft die Krankenschwester gegen Corona. Nicht Covid-19 ist das Problem, sondern die Folgen der Pandemie. Die Angst kehrt an einem Dienstag zurück. Und mit ihr der feste Wille, dieses Mal alles besser zu machen. Magdalene Fornah hat gerade Dienst im Connaught Hospital in Sierra Leones Hauptstadt Freetown, als sie von der ersten bestätigten Covid-19-Infektion im Land erfährt. Erinnerungen werden wach an den schlimmsten Ebola-Ausbruch der Geschichte. Fünf Jahre ist das erst her. Fornah ist eine kleine Frau mit großem Mut. Während der Ebola-Epidemie bekämpfte die Krankenschwester das Virus an vorderster Front.
09.04.2021 06:45:55 [Frankfurter Allgemeine Zeitung]
Haiti am Abgrund: Ein Land in Gangsterhand
Haiti steht vor dem Abgrund. Hunderte Häftlinge entkommen aus einem Hochsicherheitsgefängnis, Bandenkriminalität gehört zum Alltag, die Regierung scheint machtlos. Die Bilder wirken vertraut, obwohl sie das Ausmaß des Horrors übertreffen, an den Haiti sich notgedrungen gewöhnen musste: Kinder in Schuluniformen gehen mit abgewandten Gesichtern an auf der Straße liegenden Toten vorbei, von denen es heißt, die Polizei habe sie auf der Flucht erschossen. Ein Beamter mit Helm und kugelsicherer Weste setzt seinen Fuß auf den Rücken eines wie George Floyd mit Handschellen geknebelten, auf dem Bauch liegenden Mannes.
09.04.2021 13:28:23 [Der Freitag]
USA: Nicht nur Derek Chauvin
Beim Floyd-Prozess in Minnesota wird über mehr als Polizeibrutalität geurteilt. Dass der frühere Polizist Derek Chauvin in Minneapolis vor Gericht steht, ist der von jungen Afroamerikanern angeführten Black-Lives-Matter-Bewegung zu verdanken und den Millionen, die trotz Covid-19 auf die Straße gegangen sind. Man kann bei Youtube „black“ oder „police killing“ eingeben und sich davon überzeugen: Polizisten töten erschreckend häufig. Nur selten kommt es zum Prozess. Sie sei „pessimistisch optimistisch“, meinte Shareeduh Tate in der ersten Prozesswoche. Tate ist eine Cousine von George Floyd.
09.04.2021 14:43:52 [Amerika 21]
Ecuador: Spaltung der Indigenenbewegung könnte Wahlausgang beeinflussen
In der letzten Woche vor der Stichwahl um das Präsidentenamt in Ecuador am 11. April ist es zu offenen Differenzen innerhalb des einflussreichen Indigenendachverbands Conaie gekommen. Nachdem man bei der ersten Runde im Februar geschlossen den schlussendlich drittplatzierten Pachakutik-Kandidaten Yaku Pérez unterstützt hatte, gibt es nun offenen Streit über die Wahlempfehlung.

Am vergangenen Wochenende hatte zunächst der Präsident des Conaie, Jaime Vargas, dem linken Kandidaten Andrés Arauz öffentlich die Unterstützung zugesagt.

09.04.2021 15:49:18 [Amerika 21]
Mexiko: Militärs wegen Massaker von Tlatlaya erneut in Untersuchungshaft
Die mexikanischen Behörden haben sieben Soldaten festgenommen, die für das Massaker von Tlatlaya im Bundesstaat Estado de México schon einmal in Haft waren. Die Menschenrechtsorganisation Centro Prodh begrüßte die Verhaftung der mutmaßlichen Täter und betonte, dass dieser Schritt der Ausdauer der Angehörigen der Opfer und den Überlebenden zu verdanken sei. Die Haftbefehle wurden im Oktober 2019 von einem Gericht erwirkt, nachdem die Opfer gegen den Entscheid der Behörden, die Soldaten freizulassen, erfolgreich geklagt hatten.
09.04.2021 16:10:48 [RT DE]
Im Kalten Krieg gegen China haben die USA schlechte Karten
Teil 1: Auf Druck Washingtons wird derzeit in den EU-Ländern der Handel mit China – unter Verweis auf angebliche Menschenrechtsverletzungen in Chinas Provinz Xinjiang – durch westliche Sanktionen deutlich erschwert. Welche Folgen wird das für China und die Region haben? Ein wichtiger Bestandteil des neuen Kalten Krieges, den die Vereinigten Staaten diesmal nicht nur gegen Moskau, sondern auch gegen Peking führen, ist der Wirtschaftskrieg. Mit Wirtschafts- und Finanzsanktionen aller Art sollen die Regierungen in China und Russland in die Knie gezwungen werden – und zugleich die globale, aber inzwischen stark bröckelnde Vorherrschaft des siechenden Hegemonen USA abgestützt und für einige Jahrzehnte verlängert werden.
09.04.2021 17:27:00 [Telepolis]
USA/Iran: Werden neue Spielregeln vereinbart?
Es geht in Wien, der früheren Hauptstadt eines verblichenen Imperiums, darum, ob neue Spielregeln im Verhältnis der USA und ihrer westlichen Verbündet zu Iran festgelegt werden können. Die Dimensionen, die um diesen Konflikt herum aufgebaut werden, sind hoch angesetzt; nicht selten fällt dazu der große Begriff einer "neuen Weltordnung", wie zuletzt zum Strategieabkommen zwischen Iran und China, das, obschon es eine längere Vorgeschichte hat, als Konsequenz der US-Politik gegen Iran bewertet wird.

Die Erwartungen, die mit den gegenwärtigen Wiener Verhandlungen konkret verknüpft werden, sind dagegen niedrig angesetzt: Hauptsache die USA und Iran verhandeln wieder, wenn auch nur indirekt.

09.04.2021 17:31:23 [VoltaireNet]
Die nationale Sicherheitsstrategie von Präsident Biden
Die Biden-Administration ist voller guten Willens, aber unwissend über die Welt, wie sie ist. Unter der Leitung eines senilen Präsidenten beabsichtigt sie, die Demokratie in der Welt wiederherzustellen, ohne sich bewusst zu sein, dass die sozialen Schichten, die dieses politische Regime geschaffen haben, im Verschwinden begriffen sind. Sie hofft, das von einer Mehrheit der Völker gefürchtete amerikanische Imperium wieder herzustellen, in der Überzeugung, ihnen einen Gefallen zu tun. Schließlich will sie den "endlosen Krieg" fortsetzen, ohne jedoch das Leben von US-Soldaten auf das Spiel zu setzen. Aber das kann sie nicht erklären.
09.04.2021 19:01:48 [ISW - sozial ökologische Wirtschaftsforschung]
Bidens 2,3 Billionen-Umbauplan
US-Präsident Biden hat seinen Plan für den Umbau der US-Gesellschaft vorgestellt: 2,3 Billionen Dollar für die Modernisierung der maroden Infrastruktur und die Schaffung von rund zwanzig Millionen neuen hochmodernen Arbeitsplätzen in einer neu geformten Wirtschaft; investiert über acht Jahre, finanziert vor allem durch Erhöhung der Steuern für Unternehmungen und Jahreseinkommen höher als 400.000 Dollar. Biden will damit, wie er bei der Präsentation des Plans in Pittsburgh, einer Hochburg der alten Industrien, sagte, „die widerstandsfähigste, innovative Wirtschaft der Welt“ schaffen. Es sei „eine einmal-in-einer Generation Investition in Amerika“.
10.04.2021 06:29:37 [Der Überflieger]
Argentinien – 42 % der Menschen leben in Armut
Aus dem Armutsbericht des staatlichen Statistikinstituts Indec geht hervor, dass im zweiten Halbjahr 2020, 42 % der Bevölkerung in Armut leben. Mehr als 10 % sind sogar von extremer Armut betroffen. Zu diesem schrecklichen Ergebnis ist man gekommen, als man die Daten von 31 städtischen Ballungsräumen auswertete, in welchen ca. 29 Millionen Menschen leben. Diese Zahlen wurden auf die argentinische Gesamtbevölkerung hochgerechnet, welche ca. 46 Millionen Menschen beträgt.

Das Ergebnis ist, dass ca. 19 Millionen Menschen in Armut und sogar 4,5 Millionen Menschen in extremer Armut leben.

10.04.2021 06:38:52 [Preußische Allgemeine Zeitung]
Ein Albtraum von Stadt
In der Wüste Nevadas planen Politiker und Unternehmer „autonome Innovationszonen“, in denen Technologiekonzerne die Regierung, Verwaltung und Ordnungsbehörden stellen. Der US-Bundesstaat Nevada ist vor allem für seine Rinderherden, Bodenschätze und Spielkasinos bekannt. Das will der demokratische Gouverneur Stephen Sisolak aber nun durch die forcierte Ansiedlung von Unternehmen mit „bahnbrechenden Technologien" ändern – und zwar ohne auf die üblichen Lockmittel Steuererleichterungen und Subventionen zu setzen, wie Nevada das kürzlich noch im Falle der Gigafactory 1 von Tesla getan hatte.
10.04.2021 06:43:34 [Zeit Online]
Kolumbien: Und friedlich stirbt der Regenwald
Als die Guerilla-Kämpfer abzogen, kamen die Holzfäller. In Kolumbien riefen die Farc-Rebellen im Jahr 2014 einen Waffenstillstand aus, zwei Jahre später unterzeichneten ihre Anführer und die Regierung nach jahrzehntelangem Bürgerkrieg einen Friedensvertrag. Viele hofften damals auf eine friedliche Entwicklung des Landes, die zwar schwierig werden, aber nach und nach allen Menschen im Land zugutekommen könnte.

Doch dem kolumbianischen Regenwald hat der Friedensprozess schwer geschadet.

Von 2000 bis 2015 verzeichnete Kolumbien noch eine der geringsten Entwaldungsraten in Lateinamerika.

10.04.2021 06:45:56 [Amerika 21]
Der Plan für einen Wahlbetrug in Ecuador
In Ecuador soll ein Wahlbetrug bei der Stichwahl für das Präsidentenamt am kommenden Sonntag in Vorbereitung sein. Schlüsselakteure, Umsetzungswege und Finanzierung sind bereits in vollem Gange, wie eine Quelle aus der Leitung des Nationalen Wahlrates (Consejo Nacional Electoral, CNE) bei einem Treffen im Süden von Quito berichtet. Die Person erklärt, sie rede, um zu erreichen, dass die Präsidentschaftswahl transparent ist und um ein Manöver zu verhindern, das von zwei Schlüsselfiguren vorbereitet wird: Guillermo Lasso, Präsidentschaftskandidat der Partei Creo (Movimiento Creo, Creando Oportunidades), und Jaime Nebot, Chef der Sozialchristlichen Partei (Partido Social Cristiano, PSC).
10.04.2021 09:00:40 [WOZ - Die Wochenzeitung]
Moçambique: Der Konzern hier, die Islamisten dort
Das Erdgas hätte die grosse Chance sein sollen, doch nun herrschen Gewalt und Chaos: Der Aufstand in der Provinz Cabo Delgado hat eine neue Eskalationsstufe erreicht. Eine Art Lehrbuchbeispiel zu den Fallstricken der Rohstoffausbeutung in Afrika. Schliesslich zog Total die Reissleine. Ende letzter Woche hat das französische Mineralölunternehmen sein Gelände auf der Afungi-Halbinsel im Norden der Provinz Cabo Delgado zu evakuieren begonnen. Auf etwa siebzig Quadratkilometern Fläche ist dort eine gigantische Anlage zur Verflüssigung von Erdgas im Bau, mit eigenen Arbeiterunterkünften, Hafenanlagen und einer Flugzeuglandepiste.
10.04.2021 11:21:14 [Amerika 21]
Kritische Töne im US-Bericht über Menschenrechte in Kolumbien
Der Menschenrechtsbericht des US-Außenministeriums für das Jahr 2020 in Kolumbien hat Tötungen und Übergriffe der Sicherheitskräfte an Zivilisten unter der Regierung von Iván Duque aufgezeigt. Der Bericht prangert außerdem die schlechten Lebensbedingungen in den Gefängnissen an und verweist auf die "unzulässige" Überwachung von Bürgern durch die kolumbianischen Geheimdienste. Die Morde an Ex-Farc-Kämpfer seien Folge "unzureichender Sicherheitsgarantien", heißt es.

Das 43-seitige Dokument macht auf die "vorsätzliche Tötung" von mindestens 15 Personen durch Staatsbedienstete im letzten Jahr aufmerksam.

10.04.2021 14:58:32 [Amerika 21]
Stichwahlen in Bolivien entscheiden über Hegemonie der MAS
Am morgigen Sonntag sind die Wähler in den Departamentos La Paz, Chuquisaca, Pando und Tarija in den Stichwahlen erneut dazu aufgerufen, ihre Stimme zum Gouverneureamt abzugeben. Dort konnte bei den Regionalwahlen am 7. März keiner der Kandidaten die notwendige Mehrheit erreichen. Die Wahlen sind für das politische Machtgleichgewicht in Bolivien wichtig, da die Zentralregierung bei der Umsetzung politischer Entscheidungen auf die Unterstützung der Gouverneure angewiesen ist. Der regierenden Bewegung zum Sozialismus (MAS) werden gute Chancen ausgerechnet, in drei von vier Departamentos zu gewinnen.
10.04.2021 15:13:14 [WSWS]
Asien wird zum neuen Epizentrum der globalen Covid-19-Pandemie
Weltweit nimmt die Pandemie einen neuen Aufschwung, angetrieben durch ansteckendere Coronavirus-Varianten, und Asien ist die am stärksten betroffene Region. Von dort werden derzeit 40 Prozent der täglichen Neuinfektionen gemeldet, die insgesamt allein am Donnerstag laut "Worldometer" bei schwindelerregenden 750.000 Fällen lag.

Die Impf-Kampagne hat in Asien gerade erst begonnen. Dort werden fast 90 Prozent der neuen Fälle aus Ländern im Nahen Osten und im Indopazifik gemeldet, wo die Zahl der Infektionen innerhalb einer Woche praktisch explodiert ist und droht, alle bisherigen Rekorde zu brechen.

10.04.2021 17:08:07 [WSWS]
Wachsender Konflikt zwischen USA und China
Da die Biden-Regierung die Konfrontation zwischen den USA und China bewusst verschärft, wird Taiwan jetzt sehr schnell zum potenziellen Auslöser eines Kriegs zwischen den beiden Atommächten. Genau wie zuvor von Trump wird der diplomatische Rahmen, der seit Jahrzehnten zumindest einen unsicheren und labilen Frieden auf beiden Seiten der Taiwanstraße gewährleistet hat, jetzt auch von Biden in Frage gestellt.

Indem die USA ihre Beziehungen zu Taiwan stärken, stellen sie die Ein-China-Politik in Frage, welche die Grundlage für die Aufnahme diplomatischer Beziehungen zwischen Peking und Washington im Jahr 1979 bildete.

11.04.2021 06:56:06 [Einartysken]
Eritrea - so unbekannt wie sein Präsident Isaias Afewerki
Ich glaube, mein Blogg ist einer der wenigen, der über viele Jahre hinweg immer wieder etwas über das Land und seinen Präsidenten gebracht hat. Es ist ein kleines Land - wieviele von euch finden es auf der Landkarte? - ein armes Land, das nichts destoweniger Fortschritte macht aus eigener Kraft. Die meisten NGOs wurden rausgeworfen, weil sein bescheidener Präsident der Meinung ist, dass diese vor allem Unruhe stiften. Afewerki hat nicht nur sein Land befreit in immer neuen Kriegen und Attacken Äthiopiens, sondern hat auch von Anfang an dafür gesorgt, dass keine der vielen religiösen Gruppen Politik auf Glaubensbasis betreiben.
11.04.2021 07:07:36 [Deutschlandfunk]
Piraten vor Afrikas Küsten
Wegen regelmäßiger Piratenangriffe gilt der Golf vor Guinea an der westafrikanischen Küste als das gefährlichste Seegebiet der Welt. Was gegen die Überfälle helfen kann, zeigt die Erfahrung am Horn von Afrika: Vor Somalia, lange der Piratenhotspot, gab es seit 2018 keinen erfolgreichen Angriff mehr. Ein Piratenangriff in Westafrika, im Golf von Guinea vor der Küste Nigerias. Ein Mitglied der russischen Crew des Frachters filmt das Geschehen, verbreitet das Video später im Internet. Die Piraten nähern sich mit Schnellbooten und eröffnen das Feuer. Aber an Bord des Schiffes ist an diesem 5. Dezember 2020 ein bewaffnetes nigerianisches Sicherheitsteam, das die Schüsse der Angreifer erwidert.
11.04.2021 09:28:19 [Gift am Himmel]
Spaceport Genocide
Im Westpazifik, zwischen Australien und dem Äquator, liegt einer der meist isolierten und am wenigsten besuchten Flecken der Erde. Die zweitgrößte Insel der Welt wird immer noch von traditionellen Volksstämmen bewohnt, die Hunderte verschiedene Sprachen sprechen. Obwohl es geographisch und kulturell ein einziges Land ist, wurde dieses tropische Paradies 1848 in einem Abkommen zwischen den Niederlanden und Großbritannien durch eine in der Mitte gezogene Linie in eine westliche und eine östliche Hälfte geteilt. Sie betrachteten die dort lebenden Schwarzen nur als mögliche Quelle billiger Arbeitskräfte für den Abbau der Ressourcen ihres Landes.
11.04.2021 09:40:51 [Amerika 21]
Kuba und Deutschland wollen Zusammenarbeit im Pharmasektor ausbauen
Im Rahmen eines virtuellen Forums am 14. April wollen sich Kuba und Deutschland über Kooperationsperspektiven im Bereich Biotechnologie und Pharmazie austauschen. An dem Event, welches von der kubanischen Handelskammer zusammen mit der deutschen Auslandshandelskammer (AHK) organisiert wird, nehmen unter anderem Vertreter des Zentrums für Gentechnik und Biotechnologie (CIGB) sowie des Finlay-Impfstoffinstituts (IFV) teil, die sich für die Entwicklung der kubanischen Corona-Impfstoffe verantwortlich zeigen.


11.04.2021 11:47:32 [Amerika 21]
Ecuador wählt heute in einer Richtungsentscheidung neuen Präsidenten
Am heutigen Sonntag findet die Stichwahl für die Präsidentschaft in Ecuador statt. Insgesamt sind 13.099.150 Ecuatorianer zur Wahl aufgerufen. Es besteht Wahlpflicht mit Ausnahme der unter 18-Jährigen und Personen über 65 Jahre sowie derjenigen, die wegen Covid-19 in Quarantäne sind.

Die Wähler haben zwei gegensätzliche Wahloptionen: Der Kandidat der neoliberalen Creo, Guillermo Lasso, steht für eine Fortführung der Politik des scheidenden Präsidenten Lenín Moreno mit der Liberalisierung der öffentlichen Dienstleistungen, der Öffnung für ausländische Märkte und Investitionen und einer wohlgesonnenen Politik gegenüber Unternehmen und Privatbanken.

11.04.2021 11:56:33 [RT DE]
Von Costa Rica lernen
Eindrücke von der Corona-Krise in Mittelamerika. Der Autor des Textes verbrachte mit seiner Familie gut drei Monate in Costa Rica, um den "bedrückenden, freiheitszerstörenden Zuständen in Deutschland zu entfliehen". In diesem Bericht schildert er seine Erfahrungen – und zieht Vergleiche zu den Zuständen hierzulande. Wir hatten ursprünglich nur fünf Wochen geplant und dann zweimal, bis Anfang April, verlängert. Grund dafür waren zum einen die bedrückenden Nachrichten aus Deutschland. Dort wurde der Lockdown entgegen den anfänglichen Ankündigungen und Versprechungen von Monat zu Monat verlängert und immer schlimmer. Im Gegensatz dazu gab und gibt es in Costa Rica einen recht freiheitlichen, lockeren Umgang mit Corona.
11.04.2021 13:18:44 [Amerika 21]
Peru: Präsidentschaftswahlen auf dem Höhepunkt der Pandemie
Heute wählt Peru ein neues Staatsoberhaupt sowie ein neues Parlament. 25 Millionen Wahlberechtigte sind gesetzlich dazu verpflichtet, ihre Stimme abzugeben oder eine Geldstrafe zu zahlen – Ausnahmen gelten für Corona-Erkrankte. Wahlprognosen sagen ein knappes Rennen zwischen mehreren Kandidaten voraus.

Die Wahlen finden zu einem epidemiologisch gesehen ungünstigen Zeitpunkt statt: Erst am Dienstag verzeichnete das Land 314 Todesfälle aufgrund von Covid-19 – der bisherige Rekord seit Beginn der Pandemie. Um die Wahlen auf dem Höhepunkt der dritten Infektionswelle so sicher wie möglich zu gestalten, hat die Wahlbehörde die Zahl der Wahllokale erhöht und deren Öffnungszeiten auf zwölf Stunden ausgedehnt.

11.04.2021 13:29:20 [RT DE]
Der Aufstieg Chinas – eine Bedrohung für den Westen?
Die wohl bedeutendste Kehrtwende der EU nach dem US-Machtwechsel betrifft die Teilnahme an der Eindämmungspolitik gegen China, wovon die jüngsten Sanktionen zeugen. Zugleich wird eine Bedrohung westlicher Werte und Lebensweisen beschworen. Dass solche Ängste unbegründet sind, erschließt sich beim Befassen mit dem chinesischen Weltbild. Nach 30 Jahren Abwesenheit ist der Begriff "Systemwettbewerb" wieder allerorts präsent. Diesmal heißt der Kontrahent nicht Sowjetunion, sondern China. Das Land wird als größere Herausforderung für die westlichen Demokratien angesehen als seinerzeit das Sowjetimperium. Der Hauptgrund ist das bedeutendere Wirtschaftspotenzial bei gleichzeitig starker Verflechtung mit den westlichen Volkswirtschaften.
11.04.2021 15:14:31 [Junge Welt]
Streit in Kolumbiens Linker: Spannung und Strategie
Gut ein Jahr vor den kolumbianischen Präsidentschaftswahlen im Mai 2022 ist die Situation im linken und progressiven Lager angespannt. Die Ankündigung der afrokolumbianischen Aktivistin und Umweltschützerin Francia Márquez und der Parlamentsabgeordneten Ángela María Robledo, als Kandidatinnen zur Verfügung zu stehen, hat in der vergangenen Woche für heftige Debatten gesorgt.

Die in der kolumbianischen Politik sehr bekannten Frauen hatten die Ansage während eines am Montag und Dienstag im Bundesstaat Tolima abgehaltenen »Nationalen feministischen Konvents« gemacht. Laut Medienberichten nahmen mehrere hundert Aktivistinnen aus verschiedenen Regionen Kolumbiens daran teil.

11.04.2021 16:46:44 [TAZ]
Myanmars Militär setzt Kriegswaffen ein
Auch am Sonntag ist in mehreren Städten in Myanmar wieder gegen die Machtübernahme des Militärs demonstriert worden. Dabei war kurz zuvor bekannt geworden, dass am Freitag allein in der Stadt Bago nach Angaben von Myanmars bekannter Menschenrechtsorganisation AAPP mindestens 82 Demonstranten vom Militär getötet wurden.

Die Gesamtzahl der seit dem Putsch vom 1. Februar getöteten Demonstranten gibt AAPP inzwischen mit mindestens 701 an (Stand: Samstagabend). 3.803 Menschen sind seitdem gefangen genommen worden, von denen noch 3.012 in Gefängnissen sitzen. Hinzu kommt eine unbekannte Zahl von Verschwundenen.

11.04.2021 17:08:59 [Amerika 21]
Die gewaltvolle Prekarität der Arbeitskräfte in Brasilien
Nachdem die Regierung die Nothilfe gestoppt hat, müssen Millionen Familien neue Wege für ein Einkommen zum Überleben suchen. Seit einiger Zeit warnt der Soziologe Ricardo Antunes die politische Klasse, Akademiker, die Presse und die brasilianische Gesellschaft im Allgemeinen vor dem beschleunigten Prozess der Verunsicherung und Verschlechterung, den die Arbeitskräfte dieses Landes erleben. In seinem Buch Das Privileg der Knechtschaft (O privilégio da servidão) untersucht der Autor die Zerstörung der Kategorie "Arbeit" in Brasilien und der Welt, mit dem Aufkommen von zunehmend fragmentierten und prekären Formen einer grundlegenden Aktivität in der Kultur und der Entwicklung der Menschheit.
 Konzerne, Unternehmen, Monopole, Organisationen, Vereine, Lobbyismus, Korruption (19)
01.04.2021 09:46:41 [Süddeutsche Zeitung]
Amazon und die Fake-Profile
Ob die Arbeitsbedingungen bei Amazon wirklich das seien, was sie am meisten interessiere, wollte ein Twitter-Nutzer von "AmazonFCDarla" wissen. Und was sie täte, wenn sie an einer Schildkröte vorbeikäme, die am Wegesrand in der Wüste auf dem Rücken in der Sonne liegt. Die Frage wird im Film "Blade Runner" als Test verwendet, um anhand der Reaktion echte von künstlichen Menschen zu unterscheiden. "Darla" scheint den Test nicht bestanden zu haben, denn inzwischen ist ihr Profil gelöscht. Amazon hat damit eine Mitstreiterin in einem erbitterten Meinungsstreit verloren, den der Konzern derzeit über die sozialen Medien führt - unterstützt von einer Gruppe heillos begeisterter Angestellter, die sich in Diskussionen mit Lobpreis für ihren Arbeitgeber einmischen.
01.04.2021 11:45:13 [Junge Welt]
Daimler will Kapital belohnen
Für Großkonzerne ist die Coronakrise ein profitables Geschäft. Das bestätigt wieder einmal der Pkw- und Lastwagenbauer Daimler, der für das erste Quartal 2021 gute Geschäfte meldet. Absatz und Umsatz der Pkw-Sparte des Konzerns sollten ungeachtet branchenweiter Lieferengpässe von Mikrochips über dem Vorjahresquartal liegen, sagte Vorstandschef Ola Källenius am Mittwoch bei der digital abgehaltenen Daimler-Hauptversammlung in Stuttgart. Mit Blick auf die Profitabilität zeigte sich Källenius bei Autos ebenso zuversichtlich wie bei der Lkw- und Bussparte, die im Herbst vom Gesamtkonzern abgespaltet werden soll, um sie an die Börse zu bringen.
01.04.2021 18:52:04 [RT DE]
Amerikanische Big Tech – Eine Gefahr für Europa!
Amazon, der in Seattle, Washington, ansässige US-Onlinehändler, der europäische Kleinunternehmen in atemberaubendem Tempo in den Ruin treibt, hat kürzlich beschlossen, willkürlich Bücher zu verbieten, die seiner Meinung nach "Hassreden" beinhalten. Der US-Multi hat das Buch "When Harry Became Sally: Responding to the Transgender Movement" von seiner Online-Verkaufsplattform verbannt, wie der Sender FoxNews berichtet. Ein Buch, welches das von den Mainstream-Medien gezeichnete rosige Bild der Geschlechterfluidität der eher traurigen Realität des täglichen Lebens von Menschen mit Geschlechtsdysphorie gegenüberstellt.
02.04.2021 16:50:16 [Der Freitag]
Korruption: Wo verläuft die Grenze zum Amigo-Deal?
Es ist inzwischen ein Ritual geworden. „Jetzt endlich“, heißt es, finge die Union an, ihre Blockade wirkungsvoller Maßnahmen gegen den Missbrauch des Abgeordnetenmandats aufzugeben oder wenigstens zu lockern. Jetzt, nach der Masken-Affäre um Georg Nüßlein (CSU) und Nikolas Löbel (CDU). Aber schon als 2020 der CDU-Politiker Philipp Amthor versuchte, sein Mandat in Vorteile für sein Unternehmen umzumünzen, wurde die Union nervös und unterstützte plötzlich ein Lobbyregister. Als nun die Masken-Affäre aufgedeckt worden war, kündigte die Unionsfraktion einen neuen „Verhaltenskodex“ an. Aber tritt man den Missständen wirklich entgegen?
02.04.2021 18:59:26 [Kontext Wochenzeitung]
Bilanz der Deutschen Bahn: Stuttgart als Versuchslandschaft
Die Deutsche Bahn bricht Rekorde – bei Verlusten und Schuldenstand. Die Dauermisere mit Tendenz zum Immer-Schlimmer-Werden wurde nicht durch die Pandemie verursacht. Es handelt sich um eine strukturelle Krise, befördert durch einen grotesken Tunnelbauwahn. Die grundlegenden Fakten zur Bahnbilanz 2020 sind bekannt: Es gab im vergangenen Jahr zum ersten Mal seit Gründung der DB AG 1994 einen massiven Umsatzrückgang. Es gab einen Rekordverlust von mehr als 5 Milliarden Euro. Und es gibt eine Rekordverschuldung von inzwischen 33 Milliarden Euro.

Das Top-Management des Bahnkonzerns ließ auf der Bilanzpressekonferenz natürlich verlautbaren, dass die Pandemie Schuld an diesen tiefroten Zahlen sei.

04.04.2021 07:14:22 [Der Tagesspiegel]
PR-Desaster für Weltkonzern: Lego bringt die treuesten Fans gegen sich auf
Mit Anwälten geht Lego gegen Händler und Youtuber vor. Sympathisch wirkt das nicht. Jetzt droht den Dänen ein schwerer Schlag. Die Vorwürfe gegen ihn wiegen schwer, sagt Thorsten Klahold. Schon im wörtlichen Sinn: Der Papierstapel, den er im Dezember von der Anwaltskanzlei aus Frankfurt am Main im Auftrag von Lego bekam, habe fast 700 Gramm gewogen.

Das Dokument enthielt eine Reihe von Vorwürfen, von denen Klahold manche als „lächerlich“, andere als „traurig“, wieder andere als „absurd“ bezeichnet. Dazu die Aufforderung, eine strafbewehrte Unterlassungserklärung abzugeben. „Habe ich natürlich nicht getan“, sagt Thorsten Klahold am Telefon.

04.04.2021 15:25:47 [RT DE]
BioNTech: Wie mit Corona-Hilfen ein Milliarden-Konzern entstand
Die Erfolgsgeschichte des Mainzer Biotechunternehmens BioNTech liest sich wie ein modernes Märchen. Der Deutsch-Türke Uğur Şahin und seine Ehefrau Özlem Türeci gründeten 2008 zusammen mit dem Mediziner Christoph Huber das Mainzer Unternehmen. Adresse: An der Goldgrube 12. Die Metapher sollte bald Realität werden für die Firma. Der Schwerpunkt der Unternehmenstätigkeit lag auf der Entwicklung und Herstellung von Technologien und Medikamenten für individualisierte Krebsimmuntherapien. 2019 folgte der Börsengang an die Nasdaq. Nun bekamen beide das Bundesverdienstkreuz und demnächst womöglich den Nobelpreis.
04.04.2021 17:27:40 [Vice]
Aserbaidschan-Affäre: Der Diktator, die CDU, der Moderator und das Geld
Recherchen zeigen, wie aserbaidschanische Lobbyisten über Jahre Einfluss auf die Bundestagsfraktion der Union nahmen. In der Nebenrolle: ein gekaufter Berliner Lokalsender, der regimefreundliche Interviews sendet. Die Union steckt mitten in einer Affäre um Abgeordnete, die sich an der Pandemiebekämpfung und Maskendeals bereichert haben. Hinzu kommt ein zweiter, wahrscheinlich größerer Skandal, mit internationaler Verflechtung: Die Aserbaidschan-Affäre. Unsere Recherchen zeigen, dass die Einflussnahme des autoritären Regimes auf Unions-Abgeordnete größer ist als bisher angenommen. Dahinter steht ein Lobby-System, für das offenbar vor allem Unions-Abgeordnete anfällig waren – über Jahre.
04.04.2021 18:57:06 [RT DE]
Corona: Wie deutsche Konzerne mit staatlichen Hilfsgeldern Kasse machen
Während viele Millionen Einzelhändler und Gastronomie-Betriebe noch auf die Auszahlung der "Dezemberhilfe" warten, machen andere – etwa Großunternehmen wie Daimler – in der Krise Kasse mit dem Geld vom Staat. Das wird dann oft umgehend als Dividende an die Aktionäre ausgeschüttet. So fließt Staatshilfe indirekt an die Aktionäre. Lena Blanken von der Organisation "Finanzwende" hält das für betriebswirtschaftlich falsch. Bei ntv sagte sie:

"Daimler ist ein eindrücklicher Fall, unter anderem weil Konzernchef Ola Källenius selbst vorgerechnet hat, dass das Kurzarbeitergeld dem Unternehmen Einsparungen von 700 Millionen Euro gebracht hat."

05.04.2021 07:12:02 [RT DE]
Frisch geleakt: Amazons Troll-Armee auf Twitter
Wie die Online-Plattform "The Intercept" berichtet, wurde die "Twitter-Armee" von Amazon 2018 stillschweigend unter dem Codenamen "Veritas" aus der Taufe gehoben. Ausgewählte Mitarbeiter wurden dem Bericht zufolge geschult, um das Unternehmen und seinen Chef Jeff Bezos aus der Schusslinie zu nehmen und in den Gegenangriff überzugehen.

Vor allem soll von den "Botschaftern" Kritik an den Arbeitsbedingungen bei Amazon entschärft werden. Sie würden laut dem Bericht vor allem wegen ihres "großartigen Sinns für Humor" ausgewählt.

05.04.2021 16:10:40 [Public Eye]
Big Pharma gewinnt immer
Covid-19 zeigt beispielhaft, wie problematisch das Geschäftsmodell der grossen Pharmakonzerne ist. In ihren Schönwetter-Visionen betonen die Konzerne ihren Einsatz für die Gesellschaft, in Tat und Wahrheit nutzen sie die Covid-19 Krise zu ihrem Vorteil aus. Public Eye präsentiert, wie die 10 Strategien von Big Pharma für grösstmöglichen Gewinn auf Kosten der Gesellschaft funktionieren. Die Covid-19-Pandemie ist eine globale Krise mit gravierenden Auswirkungen auf die Gesundheit, den Lebensunterhalt und das Sozialleben der Menschen überall auf der Welt. Besonders betroffen sind aber benachteiligte Menschen – weltweit und insbesondere in Entwicklungs- und Schwellenländern.
05.04.2021 19:03:42 [TAZ]
Kritik an Klimastudie: Firmen erkaufen sich Mitsprache
Die Studie „Aufbruch Klimaneutralität“ der bundeseigenen Deutschen Energie-Agentur (dena) hat ein großes Ziel. Sie will nichts Geringeres als einen Plan aufstellen, wie Deutschland in den Bereichen Energiewirtschaft, Gebäude, Industrie und Verkehr bis 2050 klima­neutral werden kann. Kürzlich hat die dena einen ersten Zwischenbericht ver­öffentlicht. Die NGO LobbyControl kritisiert die Studie scharf. Denn sie wird zu 80 Prozent von Unternehmen finanziert, insbesondere von Gas- und Ölfirmen.

„Fossile Konzerne wie RWE oder Thyssengas kaufen sich in die Studie ein und gefährden so die Unabhängigkeit der Forschung“, sagte Sprecherin Christina Deckwirth der TAZ.

06.04.2021 09:25:47 [Buchkomplizen]
H&M: Warum es dem schwedischen Modekonzern in China an die Wäsche geht
Der schwedische Bekleidungskonzern H&M verzeichnet einen Milliardenverlust (in schwedischen Kronen) im ersten Quartal. Der Grund liegt auch in einer von China gesteuerten Kampagne und in Boykottaufrufen gegen das Unternehmen. Einige Filialen in China mussten bereits schließen, da Mietverhältnisse aufgekündigt wurden, vor anderen stehen Demonstranten, welche eine Entschuldigung fordern.

H&M hatte im Herbst 2019 die Arbeitsbedingungen in den Baumwollregionen von Chinas Westen deutlich kritisiert. Dort sollen die Uiguren und andere muslimische Minderheiten in Zwangsarbeit auf den Feldern tätig sein.

08.04.2021 16:55:32 [TAZ]
Otto will deutsches Amazon werden
Der größte Versandhändler in Deutschland, die Otto GmbH, verbucht Rekordumsatz. Den nutzt das Unternehmen, um Arbeitsplätze abzubauen. Sie ist eine der großen Coronagewinnerinnen: Die Otto GmbH & Co KG – der frühere Otto-Versand – mit über 5.620 Beschäftigten größer deutscher Onlinehändler mit Stammsitz in Hamburg. Die zahlreichen Lockdowns bescherten dem Unternehmen Rekordumsätze und einen nie da gewesenen Kundenboom. Doch wer glaubt, durch den Unternehmensaufschwung würden neue Arbeitsplätze entstehen, der irrt. Otto will den Schwung für eine Umstrukturierung nutzen, die Kosten in Milliönenhöhe und Hunderte Arbeitsplätze einsparen soll.
09.04.2021 18:56:14 [Migazin]
Wegweisendes Urteil: Ölkonzern Shell muss nigerianische Bauern entschädigen
Der Ölkonzern Shell muss mehrere nigerianische Bauern wegen der Verschmutzung von Land entschädigen. Ein Berufungsgericht im niederländischen Den Haag urteilte, dass die Tochterfirma in Nigeria für die Folgen von Lecks in Pipelines verantwortlich ist, durch die im Nigerdelta unter anderem Trinkwasser und Ackerland verseucht wurden. Vier nigerianische Bauern und die Umweltorganisation „Friends of the Earth“ hatten 2008 gegen den Konzern geklagt und mit dem Urteil nun Recht bekommen. Das Urteil von Ende Januar gilt als wegweisend für die Haftung und Verantwortlichkeit großer Konzerne.
10.04.2021 15:23:20 [Public Eye]
Syngentas Gift gegen NGO-Schädlinge
Die «Paraquat Papers» beleuchten die chronische Verantwortungslosigkeit eines multinationalen Konzerns, der alles tat, um sein hochgiftiges Pestizid Paraquat im Markt zu halten. Die Hunderte von internen Dokumenten, E-Mails und Protokollen, die Public Eye und Unearthed analysiert haben, ermöglichen auch einen einmaligen Einblick in Syngentas Strategien im Umgang mit einem Problem, das resistenter ist als jedes Unkraut: die NGOs. Es ist ein Krampf, für eine NGO wie Public Eye zu arbeiten: Wohin man auch schaut, überall gibt es Skandale aufzudecken, Ungerechtigkeiten zu bekämpfen, Systemwechsel anzustossen. Jeder Kampf kann sich über Jahrzehnte hinziehen. Die ständige Aufregung droht einen unter die Erde zu bringen, bevor das Problem (tatsächlich) gelöst ist.
10.04.2021 17:24:25 [Der Freitag]
Daimler: Auch in der Krise steigen die Gewinne
Erst kassiert der Konzern Hilfen, dann zahlt er üppige Dividenden aus. Das ist die Logik dieses Systems. Jüngst hat, wie in jedem Jahr, die Saison der Hauptversammlungen wichtiger DAX-Konzerne begonnen. Jahresberichte und Bilanzen werden vorgestellt und Gewinne vorgerechnet, Aufsichtsräte und Vorstände besetzt. Wenig überraschend: Diversity ist kein großes Thema, wenn es um die gut bezahlten Posten geht. Gesellschaftspolitik spielt eben kaum eine Rolle. Im zweiten Corona-Jahr bleiben die Hauptversammlungen digital-virtuell, Beschlüsse zu Personal und Dividenden können auch auf diese Weise getroffen werden.
11.04.2021 09:42:26 [Süddeutsche Zeitung]
Digitalkonzerne: Wenn der Mensch nur noch Mittel ist
Zalando muss sein umstrittenes Personalsystem ändern. Das sollte nur der erste Schritt sein, um Digitalkonzerne künftig stärker einzuschränken. Reden Digitalkonzerne über ihre Mitarbeiter, malen sie gern ein Paradies an die Wand. Ob Amazon oder Zalando: Da ist von Aufstiegschancen die Rede, oder von "gelebter Feedback-Kultur". Hinter der Schwurbelrhetorik verbirgt sich oft ein Alltag, der für Beschäftigte auch handfeste Nachteile hat. Deshalb hat die Berliner Datenschutzbehörde richtigerweise das Personalsystem des Modehändlers Zalando zurechtgestutzt. Dieser Eingriff sollte Signalwirkung haben: Der Staat darf die Beschäftigten in der digitalen Arbeitswelt nicht alleine lassen.
11.04.2021 11:38:57 [Neues Deutschland]
Ein offenes Ohr für Immobilienkonzerne
Eigentlich ist derzeit die große Stunde der Kontaktbeschränkungen. Doch die Bundesregierung trifft sich trotzdem gerne mit der Immobilienbranche. Vergangenes Jahr kam es zu mindestens 15 Gesprächen zwischen der Bundeskanzlerin, Bundesminister oder Staatssekretären mit Vertretern der zehn größten Immobilienkonzerne. Dies geht aus der Antwort des Bundesinnenministeriums auf eine schriftliche Frage der stellvertretenden Vorsitzenden und wohnungspolitischen Sprecherin der Linke-Bundestagsfraktion, Caren Lay, hervor, die »nd.derTag« vorliegt. Allein in den ersten drei Monaten dieses Jahres konnten die Konzerne schon viermal ihre Anliegen den höchsten Stellen der Politik vortragen. Zum Vergleich: 2019 kam es zu elf solcher Gespräche.
 Satire, Humor, Kolumne, Glosse, Kurzgeschichten (6)
01.04.2021 10:02:26 [NachDenkSeiten]
Die Schweizer Supermarktkette Migros verweigert Geimpften das Einkaufen
(Anm. v. NNE: Achtung, Aprilscherz) Während die Impf-Propaganda in den Medien auf Hochtouren läuft, erklärte der neue Geschäftsführer der Migros, Patrick Frischluft, an seiner ersten Pressekonferenz am Donnerstag, dem 1. April 2021: «Ab Sommer 2021 werden wir Menschen, die gegen Corona geimpft sind, keinen Zutritt mehr zur Migros gewähren. Auch Menschen, die eine Gesichtsmaske tragen, werden wir freundlich bitten, diese beim Eingang an den Maskenständer zu hängen. Die psychischen Erkrankungen unserer Mitarbeitenden sind in den letzten Monaten stark angestiegen – zeigen Sie wieder Gesicht und schenken sie den Migros-Mitarbeitenden ein Lächeln, sie brauchen das jetzt dringend.»
01.04.2021 15:19:55 [Netzpolitik]
65 Jahre BND: Alles Gute zum Geburtstag!
Ein Beitrag zum 1. April: Man muss es so deutlich sagen: Endlich, endlich verabschiedete der Deutsche Bundestag noch vor Ostern die Gesetzesreform zum Bundesnachrichtendienst (BND), auf die seine Mitarbeiter und jeder echte Demokrat lange Jahre gewartet haben. Die Rechtssicherheit ist nun hergestellt, die parlamentarische Kontrolle des wichtigsten deutschen Nachrichtendienstes wird weiterentwickelt und die Ausland-Ausland-Aufklärung des BND in einer Form geregelt, die einem modernen Dienst im digitalen Zeitalter entspricht. Der BND steht kurz davor, zum Leuchtturm in der internationalen Nachrichtendienst-Szene zu werden.
07.04.2021 13:04:45 [Der Freitag]
Corona-Regeln
(Satire): Strategiewechsel: Endlich Klarheit nach Ostern. Ab morgen dürfen sich noch fünf Personen in zwei Räumen bei geschlossenen oder geöffneten Türen treffen, wenn die Eltern der Kinder aus drei Haushalten kommen, die zur Hälfte systemrelevant sind. Acht Kinder können dabei fünf Erwachsene aus einem Haushalt mitbringen, wenn die Fenster geöffnet oder geschlossen sind. Ansonsten gilt immer: Der erste Haushalt ist bei einer Inzidenz unter 50 testpflichtig und muss die sich in Außenräumen aufhaltenden Haushalte über das Testergebnis umgehend informieren. Die Speichelproben werden von der Luca-App an von Chinesen betriebene und russischen Sicherheitsdiensten bewachte Biolabore in Nordmazedonien versendet.
08.04.2021 13:20:50 [NachDenkSeiten]
Schade, dass wir nicht von Clowns regiert werden!
Eine Glosse von Jens Berger: Während in Deutschland bereits über eine weitere Verschärfung des Lockdowns debattiert wird, öffnen in Großbritannien nächste Woche landesweit wieder die Kneipen und Restaurants und für den Juni haben die Briten bereits das komplette Ende aller Corona-Maßnahmen angekündigt. 1:0 für das Land, das – will man unseren Leitartiklern Glauben schenken – von einem Clown regiert wird. Was waren unsere Meinungsmacher nicht stolz auf unsere Kanzlerin: Eine Wissenschaftlerin, ja sogar eine Physikerin, sei sie! Gut, dass wir nicht von Clowns und Populisten regiert werden! Gerade in der Pandemie! Nur leider scheint das Virus diese Elogen nicht mitbekommen zu haben.
08.04.2021 19:05:04 [Politica-Comment]
Russlands Präsident Wladimir Putin im Interview zu aktuellen Fragen
(Satire): Herr Präsident, in den Deuschen Medien heisst es: Wladimir Putin spielt mit den Muskeln. Russische Soldaten und Panzer werden an die Grenze zur Ukraine verlegt. Der Krieg droht erneut zu eskalieren – auch Deutschland trägt daran eine Mitschuld.
Lange Panzerkolonnen fahren auf russischen Straßen in der Nähe der ukrainischen Grenze, Militärgerät wird auf Züge geladen, hohe Rauchsäulen steigen nach dem Beschuss durch Artillerie über Ortschaften in der Ostukraine auf. Die Bilder wecken Erinnerungen an einen Krieg, der in den letzten Jahren in Vergessenheit geraten ist.

Was halten Sie von dieser Einschätzung?

Nitschewo, alles Quatsch, bis auf die Mitschuld Deutschlands daran.

09.04.2021 19:10:37 [Egon W. Kreutzer]
Planungsbüro Wunsch & Wille: Nervenzusammenbruch
(Satire): Seit dem 11. Januar 2021 bietet der Think Tank „Planungsbüro Wunsch & Wille“ Einblicke in das politische Leben der Republik, wie sie Ihnen weder von ARD und ZDF, noch von ZEIT, Spiegel und FAZ ermöglicht werden. In der inzwischen 15. Folge dieser hart am Puls der Zeit geschriebenen Satire erreicht die Dramatik einen neuen Höhepunkt. Angela Merkel weigert sich, den längst abgesprochenen vorzeitigen Rücktritt zu vollziehen. Zitat: „Das deutsche Volk hat sich meiner bis heute würdig erwiesen. Ich kann die doch jetzt nicht im Stich lassen.“ Damit ist die Interims-Kanzlerschaft von Karl Lauterbach gescheitert. Grün-rot-rot scheint nicht mehr zu verhindern zu sein. Doch Fräulein Sabine Gnadenlos-Hempel erklärt den Widerstand für eröffnet.



 Feuilleton: Kultur, Geschichte, Literatur, TV, Fernsehen, Film, Musik, Games (66)
01.04.2021 11:25:24 [Junge Welt]
Wie der Tango nach Buenos Aires kam
Geschichte: Vier Finnen, ein Bandoneon und der Tanz des Lebens. »El tango es un pensamiento triste que se baila.« Dieser Satz – übersetzt in etwa: Der Tango ist ein trauriger Gedanke, der getanzt wird – beschreibt eine Leidenschaft, die im ersten Viertel des 20. Jahrhunderts von Argentinien und Uruguay ausgehend ganz Südamerika und schließlich auch den Rest der Welt erfasste.

Von wem aber stammt er? Gibt man den Sinnspruch in Gänsefüßchen bei Google ein, erhält man als Autor Jorge Luis Borges. Der mag zwar einer der berühmtesten Schriftsteller Argentiniens sein, vielleicht auch der berühmteste – aber von ihm ist der Aphorismus nicht.

01.04.2021 11:27:30 [Der Freitag]
Out of Africa
Eine Milliarde Menschen, bisher kaum eigene Produktionen: Nun investiert Netflix ins afrikanische Kino. Es war der Anblick der Esel, die die Kamera-Ausrüstung trugen, der Lemohang Jeremiah Mosese daran erinnerte, dass er in Lesotho filmte. Der Regisseur drehte gerade sein Filmdrama "This Is Not a Burial, It’s a Resurrection" in einem abgelegenen Teil seines kleinen afrikanischen Heimatlandes, in dem es keine Kinos gibt und – wenig überraschend – auch keinerlei Film-Infrastruktur. „Es ist schon ein bisschen wagemutig, eine Filmcrew zum Dreh an einen Ort zu bringen, an dem es keine Elektrizität gibt“, erzählt Mosese von seinem Zuhause in Berlin aus.
01.04.2021 11:29:01 [TAZ]
Neues Album von Alice Phoebe Lou
Kopfhörer auf und wegbeamen: Die südafrikanische Songwriterin Alice Phoebe Lou veröffentlicht mit „Glow“ ein neues Album. Monatelang war Lockdown „light“ im kalten Winter und jetzt geht es rein in die dritte Welle. Düstere Aussichten, aber anscheinend der beste Zeitpunkt für die südafrikanische Künstlerin Alice Phoebe Lou, um ihr Album „Glow“ zu veröffentlichen. Wenn sowieso nichts geht, einfach hinlegen, Kopfhörer auf und Wegbeamen: hin zu den Traumstränden dieser Welt. Wo man dann, wenn die Pandemie dereinst überstanden ist, am Tresen einer scheddrigen Strandbar sitzt. Sie wäre das perfekte Setting für diese Musik.
01.04.2021 11:31:36 [Qantara]
Eine Kindheit in Teheran
(Info: Ava Farmehri: "Im düstern Wald werden unsre Leiber hängen“. Roman. Aus dem Englischen von Sonja Finck. Edition Nautilus, Hamburg 2020.) Der Debütroman der iranisch-kanadischen Autorin Ava Farmehri zeichnet ein düsteres Bild einer Kindheit und Jugend im Iran nach der Islamischen Revolution. Das Buch ist ebenso ein Gefängnisroman wie eine Reflexion über die Freiheit. Und so beginnt es: Die Protagonistin Sheyda steht vor Gericht, als das Todesurteil über sie gesprochen wird. Der Fall scheint eindeutig: Sie soll ihre Mutter ermordet haben und sie hat die Tat bei ihrer Festnahme im verschneiten winterlichen Garten ihres Elternhauses sofort gestanden. Es ist Ende 1999. Sheyda ist 20 Jahre alt.
01.04.2021 11:33:32 [Netzpolitik]
Lage der Menschenrechte
Längst nicht jeder Jurist versteht sich auch als ein Anwalt des Rechts im Wortsinne oder mag größer denken als über aktuell bewegende Rechtsfragen hinaus. Wolfgang Kaleck zählt mit Sicherheit zu den Vertretern seiner Zunft, denen man beides nicht nachsagen kann. Seit Jahren streitet der Rechtsanwalt für die Menschenrechte, leistet Edward Snowden juristischen Beistand oder verklagte die CIA-Chefin Gina Haspel. Wer seine Gedanken und Argumente dazu nachvollziehen und sich zugleich über die Geschichte und die Zukunft dieses über Rechtsfragen weit hinausgehende Feld informieren möchte, kann sein in diesen Tagen erscheinendes Buch „Die konkrete Utopie der Menschenrechte. Ein Blick zurück in die Zukunft“ lesen.
01.04.2021 11:35:06 [Junge Welt]
Nase im Wind
Aber ein bisschen trauriger: Peter Licht hat ein neues Album. Man nehme einen Zweierhaushalt. Der eine Teil findet Peter Licht (eigentlich: PeterLicht) gut, egal, was er macht, der andere mag Peter Licht vor allem wegen der Texte, die Musik findet er zweitrangig. Argumente finden sich für beide Seiten: Peter Licht ist ein Tausendsassa, der 2001 mit »Sonnendeck« einen frühen klubkompatiblen Radiohit hatte, der immer noch gern gespielt wird; danach spezialisierte er sich auf kritisch-lustige Texte, während seine Musik die Form eines flockigen Singer/Songwritertums annahm, das auch »Folkpop« genannt werden kann.
02.04.2021 11:47:55 [Frankfurter Allgemeine Zeitung]
Matthäus-Passion auf CD: Gesang innigen Schuldbewusstseins
Die Matthäus-Passion von Johann Sebastian Bach ist ein Monumentalwerk. Hans-Christoph Rademann und die Gaechinger Cantorey nähern sich ihr durch Behutsamkeit und Verinnerlichung. Nikolaus Harnoncourt erzählte die Geschichte vom Leiden Christi dagegen in all ihrer Drastik. Wer unter Passionszeit vor allem Fastenzeit versteht, müsste um Johann Sebastian Bachs „Matthäus-Passion“ einen großen Bogen machen. Das Einzige, was Bach hier nicht wollte, war – Verzicht. Vielmehr schien er 1727 von visionärem künstlerischen Willen getrieben, sich selbst und alles bisher Dagewesene zu überbieten: mit einem Monumentalwerk von überzeitlicher und überkonfessioneller Wahrhaftigkeit. Sogar den Zweifel an der Heilsgeschichte hat Bach hier mit einkomponiert.
02.04.2021 11:49:56 [Deutschlandfunk Kultur]
Bob-Dylan-Anthologie „Look out kid“: „Mythische Momente der Rockgeschichte“
Im Mai wird Bob Dylan 80 Jahre alt. Zu Ehren von „His Bobness“ ist jetzt die literarische Anthologie „Look out kid“ erschienen. Dieser Band ist voller Geschichten, die von Dylan und seinen Liedern erzählen. Einige Storys sind dem Leben abgeschaut, andere komplett erfunden, ganz wie die Songs des Meisters. Neben Christiane Rösinger, Benedict Wells, Judith Holofernes, Robert Stadlober oder Marion Brasch ist auch der Journalist Tom Kummer mit einem Text vertreten: „Ballad of a Thin Man“.
02.04.2021 11:52:02 [Süddeutsche Zeitung]
DSDS ohne Dieter Bohlen: Das Ende der Klobürsten-Ära
Am Samstag ist das "Deutschland sucht den Superstar"-Finale zu sehen. Es wäre der letzte Auftritt von Dieter Bohlen gewesen, der das Rüpelhafte zum Markenzeichen erhoben hat. "Die Zeit, dass ich mir alles gefallen lasse, ist vorbei." Dieter Bohlen hat Instagram diesen erstaunlichen Satz über seinen Rauswurf aus der Castingshow DSDS anvertraut. Am Samstag ist das Deutschland sucht den Superstar-Finale auf RTL zu sehen. Das wäre des gefeuerten Poptitans letzter Auftritt gewesen. Krankheitsbedingt wird aber Bohlen, 67, von Thomas Gottschalk ("Ein Titan lässt den anderen nicht hängen"), 70, schon seit der letzten Sendung vertreten.
02.04.2021 11:55:17 [Qantara]
"Die Magie der Musik überwindet alle Grenzen"
Seit Beginn der syrischen Revolution stellt Malek Jandali sein musikalisches Schaffen in den Dienst der Menschen und ihr Ringen um Freiheit – insbesondere in den Dienst der Kinder. Sein neuestes Album fügt sich in seine Mission, das reiche musikalische Erbe seines Heimatlandes zu bewahren und darzustellen. Malek Jandali: Die Arbeit an großen symphonischen Werken beginnt bei mir immer am Klavier. Dort experimentiere ich zunächst mit Motiven, rhythmischen Mustern und alten Melodien aus dem reichen syrischen Erbe. Als nächstes skizziere ich die Hauptstruktur des Werks. Zum Abschluss "male" ich die Orchestrierung auf meine musikalischen Leinwände, wobei ich die vielfältigen Klänge und Effekte eines Sinfonieorchesters ausschöpfe.
02.04.2021 11:57:36 [Süddeutsche Zeitung]
Neues Album "Justice" von Justin Bieber: Blitzeblank
Justin Bieber hat ein neues Album. Man hört: Der Mann ist jetzt tiefgläubig und verheiratet. In der Mitte des Albums wird als Interlude eine Predigt eingeschoben, damit man gewappnet ist für die zweite Hälfte. Wenn man dann "Die for you" hört, weiß man - die erbauliche Predigt war bitter nötig: Hallverwaberter Softrock, der so dermaßen nach Retorte klingt, dass es völlig absurd anmutet, wenn Bieber vom Sterben singt. Wo kein einziger Ton mehr lebendig wirkt, ist der Tod doch längst besiegt? In "Hold On" singt er dann "We all make mistakes". Leider hört man das nicht auf dem Album. Es ist eine musikalische Festung. Man würde über "Justice" gerne sagen, dass es ein einziger gigantischer Fehler ist.
02.04.2021 12:00:31 [Der Freitag]
Mittel der Macht
(Info: Halbwahrheiten. Zur Manipulation von Wirklichkeit, Nicola Gess, Matthes & Seitz 2021, 157 S., 14 €) Literatur: Nicola Gess hat analysiert, welche Rolle Halbwahrheiten im postfaktischen Diskurs spielen. Schon in Lukian von Samosatas "Lügengeschichten" ruft Tychiades aus: „So groß ist die Macht der Lüge über den gemeinen Menschenverstand!“ Nicht zuletzt führt der große Satiriker diese Macht auf die Lust an der Lüge und auf ihre Verführungskraft zurück. Auch ist sie kein Klassen- oder Bildungsproblem. Mit einer moralischen Betrachtung und dem Plädoyer für mehr Bildung ist es also nicht getan, will man das Phänomen begreifen.
03.04.2021 11:02:55 [Süddeutsche Zeitung]
Neue Filmtechnik: Revolution in Hollywood
Special-Effects-Experten haben eine magische Lichtkuppel aus Milliarden LEDs konstruiert. Sie wird das Filmemachen von Grund auf verändern. Der Motorradfahrer hat angehalten und betrachtet die Landschaft voller Felszacken, die wuchtig in den Himmel ragen. Ist das eine echte Landschaft? Und steht der Mann wirklich darin? Man hat nicht den geringsten Zweifel. Das Graublau des Himmels wird von seinen Haaren und seiner Lederjacke reflektiert, in seiner Sonnenbrille und im Chrom seiner Maschine spiegeln sich Fels und Himmel.

Dann aber tritt ein Techniker mit einer Fernbedienung neben ihn.

03.04.2021 11:04:56 [Junge Welt]
»Was sind das für Menschen?«
(Info: Ella Cara Deloria: Waterlily. Aus dem amerikanischen Englisch von Frank Elstner und Uta Millner, Palisander-Verlag, Chemnitz 2021, 359 Seiten, 22,90 Euro) Das Verschwinden einer Kultur: Ella Cara Delorias Roman »Waterlily« beschreibt die Vertreibung der US-Ureinwohner. Es gibt viele belletristische Werke, die vorgeben, ihre Leser über das Leben der Ureinwohner Nordamerikas zu informieren. Die meisten davon taugen nichts, wurden von Leuten geschrieben, die die geschilderten Ereignisse und die beschriebenen Landschaften höchstens vom Hörensagen kannten. Anders verhält es sich mit Ella Cara Deloria und ihrem Roman »Waterlily« von 1944, der nun erstmals in einer deutschen Übersetzung vorliegt.
03.04.2021 11:06:50 [Radio FM4]
Juli Zehs Roman „Über Menschen“
(Info: Juli Zeh „Über Menschen“ ist 2021 bei Luchterhand erschienen.) Klimakrise, Coronakrise, Familienkrise und dann auch noch Nazis nebenan - all das ist Thema in Juli Zehs neuem Roman „Über Menschen“. Und dabei ist das eine überraschend zärtliche Auseinandersetzung mit der Gegenwart und ein absoluter Page-Turner. Astronauten seien die nettesten Menschen der Welt, hört die Hauptfigur in Juli Zehs neuem Roman im Radio. „Über Menschen“ heißt das heute erschienene Buch, in dem es - zwischen dem Weltall auf YouTube und dem Abgrund im Nachbargarten - vor allem um unser Miteinander geht. Nach dem Bestseller „Unter Leuten“, der als Serie verfilmt worden ist, spielt auch „Über Menschen“ fern der Stadt in der deutschen Provinz. Die Geschichte, die Juli Zeh hier erzählt, könnte gegenwärtiger gar nicht sein.
03.04.2021 11:10:04 [Der Freitag]
Der kaputte Rechtsstaat
(Info: Rechtsstaat am Ende. Ein Oberstaatsanwalt schlägt Alarm, Ralph Knispel, Ullstein 2021, 240 S., 22,99 €) Der Berliner Staatsanwalt Ralph Knispel prangert den Zustand der deutschen Justiz an. Es geht ihm nicht gut, dem Rechtsstaat, das sagen nicht nur AfD-Leute. Seit Jahren dringen aus der Justiz Hilferufe an die Öffentlichkeit. Doch die Politik reagiert auf die Probleme, wenn überhaupt, nicht angemessen, findet Ralph Knispel. Er arbeitet seit 30 Jahren als Staatsanwalt und hat mit dem Buch Rechtsstaat am Ende jetzt eine Generalabrechnung veröffentlicht. Der Berliner Oberstaatsanwalt legt den Finger in viele Wunden der deutschen Justiz, nennt die Zustände „katastrophal“.
03.04.2021 11:12:09 [Junge Welt]
Corona: Alles wie gehabt – nur schlimmer
(Info: Slavoj Zizek: Pandemie! Covid-19 erschüttert die Welt. Aus dem Englischen von Aaron Zielinski, Passagen-Verlag, Wien 2020, 112 Seiten, 15,30 Euro) Wir lernen, dass wir nichts lernen: Slavoj Zizek hat ein brauchbares Bändchen über die Pandemie geschrieben. Die alte Hegelsche Einsicht, das einzige, das wir aus der Geschichte lernen könnten, sei, dass wir nichts aus der Geschichte lernen, wird durch den Verlauf der Pandemie bestätigt. Es wurde erneut zu früh gelockert, dem Drängen der Wirtschaft und des Shopping- und Partyvolks nachgegeben, und prompt sind wir in die dritte Welle gestolpert, die heftig zu werden droht. Ostern werden wir im dritten Lockdown verbringen.
03.04.2021 11:14:45 [Radio FM4]
Mira Lu Kovacs: Songs übers Scheitern und die Selbstliebe
Die begnadete Sängerin Mira Lu Kovacs hat ein Überlebensalbum geschrieben, ehrlich, offen und unglaublich berührend. „What Else Can Break“ ist ein zartes Popalbum mit therapeutischer Wirkung. Ein schleppender Schlagzeug-Beat, eine leicht scheppernde Akustik-Gitarre und die einnehmende, zerbrechliche Stimme von Mira Lu Kovacs eröffnen das neue Soloalbum „What Else Can Break“. Der Song „Stuck“ steht nicht grundlos an der ersten Stelle des neuen Songzyklus.

Mira Lu Kovacs: „In dem Lied geht es darum, dass man das Gefühl hat, nicht weinen zu können, obwohl man möchte. Es ist ein unangenehmes und schreckliches Gefühl und man steht neben sich, wenn man merkt, dass etwas rausmöchte, aber kein Ventil hat."

04.04.2021 11:04:31 [Der Freitag]
1941: Die Killer kommen
Geschichte: Der NS-Staat rüstet zum Überfall auf die UdSSR. Nicht nur die Aggression an sich, auch die wirtschaftliche Ausbeutung zu erobernder Gebiete ist minutiös durchgeplant. Seit Deutschland ab September 1939 in Europa Krieg führt, ist Alfred Rosenberg als Chefideologe des Regimes vorübergehender Versenkung entrissen. Erst führt er einen Stab, der in Polen, Frankreich und Belgien Kulturgüter raubt, dann folgt am 20. April 1941 eine wegweisende Beförderung: Rosenberg wird „Beauftragter des Führers für Fragen des osteuropäischen Raumes“. Nach dem Überfall auf die Sowjetunion am 22. Juni 1941 darf er sich „Reichsminister für die besetzten Ostgebiete“ nennen.
04.04.2021 11:06:25 [Multipolar]
Aufklärung oder Autorität?
(Info: Günter Kampf: Corona-Maßnahmen – Nutzen, Risiken und Folgen, Tredition 2021, 340 Seiten, 18 Euro) Prof. Günter Kampf, Facharzt für Hygiene und Umweltmedizin, hat ein Buch geschrieben, in dem er Nutzen und Risiken der Corona-Maßnahmen einander gegenüberstellt. Multipolar veröffentlicht einen Abschnitt daraus, in dem es um die Politisierung der Wissenschaft und die unrühmliche Rolle von Ärztefunktionären dabei geht. Kampf mahnt: „Es ist höchste Zeit, das Verleumden und Beleidigen andersdenkender Kollegen zu beenden und strittige Fragen im Sinne der Aufklärung in einem ergebnisoffenen und respektvollen Dialog zu klären.“
04.04.2021 11:08:17 [TAZ]
Neuer Roman „The German Girl“: Ein Jahrzehnt auf Speed
(Info: Ulrike Sterblich: „The German Girl“. Rowohlt Verlag, Hamburg 2021, 384 Seiten, 20 Euro) Ulrike Sterblich erzählt von deutsch-amerikanischen Amphetamin-Freundschaften. Und liefert eine eigens kuratierte Playlist zu ihrem Roman. Immer wieder liegen da diese Bartstoppeln im Waschbecken. In ihrem New Yorker Apartment, bei der Rückkehr in ihre Heimatstadt Berlin, wo sie im feinen Hotel Kempinski am Ku’damm residiert, sogar im mexikanischen Acapulco bei einem Shooting für Nylonstrumpfhosen: Überall entdeckt das German Girl Mona Friedrich dieselben rotbraunen Haarspitzen im Bad.

Als wäre noch jemand in ihren vier Wänden oder hätte zumindest heimlich Zugang dazu.

04.04.2021 11:10:11 [Junge Welt]
Ohrfeigen zum Mittagsschlaf
(Info: Anja Röhl: Das Elend der Verschickungskinder. Psychosozial-Verlag, Gießen 2021, 305 Seiten, 29,90 Euro) Wie Anja Röhls »Das Elend der Verschickungskinder« mein eigenes verschüttetes Trauma ans Licht holte. Es ist eine Binsenweisheit, dass Veränderungen nur durchsetzt, wer selbst quälende gesellschaftliche Verhältnisse erleidet. Sind die Betroffenen jedoch Kinder, kann es dauern. Oft können sie selbst erst als Erwachsene aktiv werden, wenn sie gelernt haben, wie das geht: Sich wehren, Widerstand leisten. Brennend aktuelles Beispiel ist das hundertausendfache Elend der sexuellen Gewalt gegen Kinder und Jugendliche durch kriminelle Täter der Amtskirchen und die Duldung und Vertuschung durch ihre Oberen.
04.04.2021 11:12:49 [Der Freitag]
Junge Hunde
Jazz galt lange als betulich, jetzt sind experimentelle Spielarten wieder angesagt. Mathias Modica will sie jenseits der Szene-Clubs bekannt machen. In seinen besten Zeiten stand Jazz immer für Experiment und Zukunft. Tomorrow Is The Question! nannte der Free-Jazz-Pionier Ornette Coleman 1959 ein prophetisches Album, um noch im selben Jahr "The Shape of Jazz To Come" nachzuschieben. Die 60er und 70er Jahre waren eine Blütezeit des Jazz: Gesellschaftlicher Wandel und der Kampf um Bürgerrechte gingen einher mit radikal neuen musikalischen Formen und Klangfarben.
04.04.2021 11:15:42 [Zeit Online]
Hilary Leichter: Kein Job ist sicher
(Info: Hilary Leichter, "Die Hauptsache". Aus dem Englischen von Gregor Runge. Arche Verlag, Zürich 2021. 224 S., 20 €) Für immer Aushilfe: Hilary Leichters Roman "Die Hauptsache" steigert die spätkapitalistische Arbeitswelt zur unterhaltsamen Groteske. Eine junge Frau liegt zwischen Mülltonnen, vom Regen durchnässt und verkatert. Zum Glück findet sie jemand, hilft ihr auf, besorgt ihr Arbeit. Kurz darauf wohnt sie in einem schönen Haus und lebt ein entspanntes Mittelstandsleben. Eine Aufstiegsgeschichte? So läuft das in Hilary Leichters Debütroman "Die Hauptsache" nicht. Der Retter in der Not ist ein Siebenjähriger, dessen Mutter kürzlich verschwunden ist, und nun ist eben eine Vertretung gefragt. Für ein paar Jahre funktioniert das Arrangement, scheinbar mehr Familien- als Businessmodell.
05.04.2021 11:43:48 [Der Freitag]
Neu! Anders! Besser!
Der Ruf nach Öffnung ist laut. Doch wollen wir in die Kulturindustrie vor der Pandemie überhaupt zurück? Manche Entwicklungen sind vielversprechend. Resilienz, rufen Esoterikerinnen, Selbstverwirklicher, Resilienz müsse man lernen, um der Krise beizukommen: individuelle Widerstandsstrategien. Soziologische Betrachtungen weisen darauf hin, dass mit diesem Konzept falsche Vorstellungen verbunden werden – strukturelle Gründe einer Pandemie lassen sich so weder begreifen noch verändern. Kollektiv ist nichts daran. Im Bild der Resilienz liegt ein konservativer Denkfehler, ein nostalgisches Moment: Der Glaube, wir könnten geimpft wieder zurück zu Leben und Umständen von vorher.
05.04.2021 11:46:35 [TAZ]
Neuer Roman von Kazuo Ishiguro: Die gekaufte beste Freundin
(Info: Kazuo Ishiguro: „Klara und die Sonne“. Aus dem Englischen von Barbara Schaden. Blessing Verlag, München 2021. 352 Seiten, 24 Euro) In „Klara und die Sonne“ zeigt Kazuo Ishiguro unsere Leistungsgesellschaft. Und zwar durch die Augen eines Roboters in Mädchengestalt. Es ist so leicht, hereinzufallen auf diese Prosa. Kazuo Ishiguro, der vor vier Jahren für manche überraschend den Nobelpreis für Literatur erhielt, beherrscht die Kunst des literarischen Understatements wie kein zweiter. An der Oberfläche glatt, sanft, stets wohltemperiert scheinen seine Sätze wie von selbst über das Papier zu gleiten. Absolut unangestrengt gleiten Auge und Geist mit.
05.04.2021 11:48:56 [Junge Welt]
Comic: »Wärst du noch so hot wie früher«
(Info: Paulina Stulin: Bei mir zuhause. Jaja-Verlag, Berlin 2020, 612 Seiten, 35 Euro) »Bei mir zuhause«, der dritte autobiographische Comic der Darmstädter Künstlerin Paulina Stulin, ist ziemlich vieles gleichzeitig: eine Offenlegung ihres eigenen Lebens, vielleicht sogar ein Tagebuch, ein Dokument des Alltags, eine Feier der Begegnungen, ein Politikum auf gleich mehreren Ebenen, eine Comicreportage über das Dasein in den urbanen und subkulturellen Strukturen einer kleineren Großstadt; mit über 600 Farbseiten im Hardcover zu gerade mal 35 Euro für den Jaja-Verlag mindestens ein editorisches Wagnis, ein künstlerisches für die fünf Jahre am Werk arbeitende Zeichnerin sowieso und ganz grundsätzlich die klügste Slice-of-Life-Erzählung seit Jahren.
05.04.2021 11:52:10 [Frankfurter Allgemeine Zeitung]
Unterdeutschland – Das neue Buch von Olaf Arndt
Science-Fiction, Politik und Dystopie: Von allem ist etwas dabei. Olaf Arndt ist in seinem neusten Roman „Unterdeutschland“ einer terroristischen Wolken-Verschwörung auf der Spur. Wir neigen im Allgemeinen zur Überschätzung der Bedeutung von Schwerkraft.“ Welch ein kapitaler Satz! Doch der Chef des European Security Council will in der als Paralleluniversumsausgabe von „Anne Will“ erkennbaren Fernsehsendung gar nicht die Naturgesetze in Frage stellen, sondern in typisch sesselbreiter Talkshowdiktion ausführen, warum „Azova“ – so haben „die Medien“ das als bedrohlich wahrgenommene Phänomen über Berlin genannt – den Hauptstädtern nicht auf den Kopf fällt wie Newton der Apfel: Es handele sich bei der „anthropomorphen Flugeinheit“ nämlich um eine Wolke.
05.04.2021 11:54:23 [TAZ]
Neues Album von Camilo Lara: Ode an den Distrito Federal
„D.F.“, das neue Album von Camilo Laras Soloprojekt Mexican Institute of Sound, ist eine Liebeserklärung an die mexikanische Hauptstadt. Bei dem Namen stellt man sich eine gläserne Eingangshalle mit Portier und moderne, lichtdurchflutete Büros vor. Das Mexican Institute of Sound (MIS) ist aber lediglich ein Einmannbetrieb, hinter dem der Produzent und Musiker Camilo Lara steckt.

Der Mittvierziger versorgt uns mittlerweile schon gute 15 Jahre mit überdrehten bass-schweren Pop-Collagen, für die Lara regelmäßig Versatzstücke der mexikanischen Populärkultur verarbeitet.

05.04.2021 11:56:46 [Junge Welt]
Ermittlungen der Vorstellungskraft
(Info: Ottessa Moshfegh: Der Tod in ihren Händen. Aus dem Amerikanischen von Anke Caroline Burger. Hanser Berlin, Berlin 2021, 256 Seiten, 22 Euro) Ottessa Moshfeghs neuer Roman ist ein ebenso raffinierter wie erfindungsreicher Krimi im Konjunktiv. Es beginnt mit einem Gassigang. Vesta Guhl, die Ich-Erzählerin, eine 72jährige Witwe, ist mit ihrem Hund im Wald und findet einen Zettel. »Sie hieß Magda«, steht darauf, und: »Niemand wird je erfahren, wer sie ermordet hat. Ich war es nicht. Hier ist ihre Leiche.« Doch weit und breit ist keine Leiche zu sehen. Ein Rätsel!
06.04.2021 10:58:29 [Radio FM4]
„Ministerium der Träume“
Hengameh Yaghoobifarahs starkes Romandebüt „Ministerium der Träume“. Nasrin ist eine lesbische Türsteherin, eine trauernde Schwester, eine überforderte Tante und Überlebende von sexuellem Missbrauch. In Hengameh Yaghoobifarahs Debüt „Ministerium der Träume“ erzählt sie von einer Flucht nach Deutschland, rechtsradikaler Gewalt im Deutschland der 1990er Jahre und den Albträumen, die sie nachts heimsuchen. Das „Ministerium der Träume“ ist eigentlich ein Archiv für die Albträume der Protagonistin. Denn nachts träumt Nasrin von ihrem toten Vater, der vom Regime in Teheran hingerichtet wurde. Oder von dem rechtsradikalen Sexualstraftäter, der sie als zwölfjähriges Mädchen vergewaltigt hat.
06.04.2021 11:01:59 [TAZ]
Bären haben die Musik
Mit „Promises“ veröffentlichen der Londoner Elektroniker Floating Points und US-Jazzsaxofonist Pharoah Sanders eine vibrierende Kollaboration. Was nach Engelsharfen und Glasperlenspiel klingt, ist in Wirklichkeit ein Cembalo. Es grummelt kaum vernehmbar in der Ferne, dazu poltert ein Klavierdeckel, der auf- und zugeklappt wird und dabei scharrt wie ein Perkussionsinstrument.

Von Einkehr bis Aufbruch ist mächtig was los auf „Promises“: das gemeinsame Album des britischen Elektronikproduzenten Sam Shepherd (Floating Points) mit dem US-Freejazzsaxofonisten Pharoah Sanders und dem London Symphony Orchestra, aufgenommen über einen Zeitraum von fünf Jahren.

06.04.2021 11:04:04 [Zeit Online]
"Deacon": Ach, die Liebe!
Der Sänger Serpentwithfeet brachte Oper und Pop zusammen. Nun treibt er Lovesongs die Biederkeit aus: Sein neues Album feiert Hochgefühle der queeren Liebe. Wie jeder gute Mensch hat auch Josiah Wise eine Lieblingspflanze. In seinem Fall ist es die Hyazinthe, ihr widmet er den ersten Song auf seinem zweiten Album Deacon. Wise, der sein Pop-Projekt Serpentwithfeet und sich selbst nur noch Serpent nennt, erzählt darin eine Verwandlungsgeschichte. Aus einer Pflanze neben seinem Bett wird im Verlauf von Hyacinth ein Mann in seinem Bett. Folkpicking und Klavierakkorde täuschen dazu eine Unschuld vor, die das Stück schon mit seiner zweiten Strophe ablegt.
06.04.2021 11:05:36 [Junge Welt]
Soul: Staub auf dem Regenbogen
Mit ihrem dritten Album gelingt Valerie June eine formvollendete Mischung aus Tradition und Träumerei. Nicht alle Energiequellen, die Valerie June für ihr neues Album anzapft, sind irdischen Ursprungs: »The Moon and Stars: Prescriptions for Dreamers« wendet sich an das Weltall, an den Mond und die Sterne, um dort nach Inspiration zu suchen, und spiegelbildlich nach innen ins verborgene Universum der eigenen Träume, die niemals und nirgendwo enden. Im Video zum Song »Why the Bright Stars Glow« strahlt denn auch die Sonne golden am Himmel, die Wolken leuchten im Abendrot, und während das rosafarbene Gewand der Sängerin im Wind flattert, regnen im Hintergrund Sternschnuppen vom nächtlichen Firmament.
06.04.2021 11:08:33 [Der Freitag]
Deutschlands Krieger
(Info: Deutsche Krieger. Vom Kaiserreich zur Berliner Republik – eine Militärgeschichte, Sönke Neitzel, Ullstein 2020, 816 S., 35 Euro. ISBN 978-3-549-07647-2.) Welche Rolle spielte das Militär in der neueren deutschen Geschichte? Der Militärhistoriker Sönke Neitzel hat mit „Deutsche Krieger“ eine Bestandsaufnahme vorgelegt. Zumindest in den Milieus links der Mitte gilt Militär gemeinhin als nicht so sexy. Es ist da; wenn es sein muß (oder entsprechende Gründe vorgegeben wurden), wird es – siehe Afghanistan oder Kosovo – durchaus auch eingesetzt. Dann und wann macht es in Form seiner eigenen Skandale von sich reden.
06.04.2021 11:12:35 [Preußische Allgemeine Zeitung]
Seit Langem gibt es Vorbereitungen auf Terrorangriffe mit biologischen Waffen
(Info: Paul Schreyer: „Chronik einer angekündigten Krise. Wie ein Virus die Welt verändern konnte“, Westend Verlag, Frankfurt/Main 2020, broschiert, 176 Seiten, 15 Euro) Wer behauptet, die Corona-Pandemie hätte die westliche Welt unvorbereitet getroffen, der irrt oder sagt die Unwahrheit. Das zeigt das gründlich recherchierte Buch „Chronik einer angekündigten Krise" in absoluter Deutlichkeit. Denn darin weist der freie Journalist Paul Schreyer nach, „wie intensiv und wie lange schon ein solcher Virusausbruch immer wieder geübt wurde, ... und wie regelmäßig man in diesem Zusammenhang auch einen politischen Ausnahmezustand einschließlich ... der Einschränkung von Bürgerrechten durchgespielt hat?"
07.04.2021 10:35:39 [Zeit Online]
Stefano Mancuso: Achtet, was wächst!
(Info: Stefano Mancuso: Die Pflanzen und ihre Rechte Eine Charta zur Erhaltung unserer Natur; Klett-Cotta, Stuttgart 2021; 160 S., 18,– €, als E-Book 13,99€) Der Biologe Stefano Mancuso kämpft für die Rechte der Pflanzen, ignoriert aber leider die Philosophie der Natur. Manche Rankpflanze ahmt Form und Farbe der Blätter des Baums nach, an dem sie hochwächst. Eine Wurzel bemerkt Hindernisse und wählt den kürzeren Weg drum herum. Pilze und Grünalgen kooperieren miteinander, sodass sie sich zu symbiotischen Lebensgemeinschaften verbinden, die wir als Flechten kennen. Aufgrund solcher Beobachtungen ist Stefano Mancuso überzeugt, dass Pflanzen Sinne haben, imitieren, entscheiden und helfen können.
07.04.2021 10:37:49 [Blätter]
Befreiung als Balanceakt
(Info: Emilia Roig, Why we matter. Das Ende der Unterdrückung, Aufbau Verlag, Berlin 2021, 397 Seiten, 22 Euro.) Mit einiger Verzögerung hat sich die Auseinandersetzung mit Rassismus und kolonialer Geschichte inzwischen auch in Deutschland einen festen Platz innerhalb der Linken und im Feminismus erobert. Das Konzept der „Intersektionalität“, wonach unterschiedliche Unterdrückungsmechanismen wie etwa Rassismus und Sexismus sich „überkreuzen“, sich also nicht nur einfach aufaddieren, sondern auch gegenseitig beeinflussen, ist mittlerweile in vielen politischen Kontexten gängig – auch wenn nicht immer genau klar wird, was damit gemeint ist, und der Begriff manchmal auch als Schlagwort dient.
07.04.2021 10:39:35 [Infosperber]
Erhellende Einblicke in den Iran
(Info: Natalie Amiri: «Zwischen den Welten – Von Macht und Ohnmacht im Iran». Aufbau Verlag, 2021, 254 Seiten.) Die Journalistin Natalie Amiri analysiert in einem klugen Buch die Lage in Iran.

Die mediale Vermittlung Irans, eines der Schlüsselländer zu Krieg oder Frieden in diesem Jahr, ist – um es gelinde auszudrücken – armselig. Die meisten grossen Medien lassen ihre Journalisten allenfalls für aktualitätsbezogene Berichte kurzzeitig akkreditieren, aber ein Büro in Teheran leisten sich immer weniger. Grund dafür sind nicht nur die Sparmassnahmen der Redaktionen im Bereich des Internationalen.

07.04.2021 10:42:04 [Tichys Einblick]
Wie Deutschland links und grün wurde
(Info: Rainer Zitelmann, Wohin treibt unsere Republik? Wie Deutschland links und grün wurde. Books on Demand, Norderstedt 2021, 266 Seiten, 19,99 Euro.) Es gibt politische Bücher, die sind schon nach ein oder zwei Jahren überholt. Manche These hält nur einen Sommer. Doch das Buch „Wohin treibt unsere Republik? Wie Deutschland links und grün wurde“ von Rainer Zitelmann ist sogar nach mehr als einem Vierteljahrhundert noch lesenswert. Es enthält hellsichtige zeitgeschichtliche Analysen und Aussagen, die erklären können, wie und warum wir in der linksgewendeten Merkel-Republik gelandet sind. Und das, obwohl Zitelmanns Buch 1995 erschien. Nun hat er 2021 eine Neuauflage mit einem neuen Vorwort herausgebracht.
07.04.2021 10:44:45 [Der Freitag]
1917: Gegen jeden Krieg
Zeitgeschichte: Jeannette Rankin aus Montana wird als erste Frau in den US-Kongress gewählt und sorgt für Aufsehen: Sie lehnt den Eintritt ihres Landes in den Ersten Weltkrieg ab. Und dann war hohe Politik nicht mehr exklusive Männersache: Am 2. April 1917 nahm Jeannette Rankin aus Montana im Nordwesten der USA an ihrer ersten Sitzung im Repräsentantenhaus teil. Sie war die erste Frau im Kongress. Vier Tage später stimmte die Pazifistin gegen den Eintritt der USA in den Ersten Weltkrieg. Die Zeitung "Tribune" in Great Falls (Montana) schrieb darüber: „Fräulein Rankin ... blieb beim ersten Aufruf zur Stimmabgabe mit gesenktem Kopf sitzen.“ Beim zweiten sei sie aufgestanden und habe mit schluchzender Stimme erklärt: „Ich will meinem Land beistehen, doch ich kann nicht für Krieg stimmen.“
07.04.2021 10:47:05 [Junge Welt]
An den Grenzen der Ermittlung
(Info: Michael Wildenhain: Die Erfindung der Null. Verlag Klett-Cotta, Stuttgart 2020, 295 Seiten, 22 Euro) Kein simpler Krimi: Der Roman »Die Erfindung der Null« mischt auf faszinierende Weise literarische Genres. Die Ausgangssituation des Romans ist einfach: Ein promovierter Mathematiker, der sich als Nachhilfslehrer verdingt, wird zum Gegenstand eines Kriminalfalls. Französische Behörden melden eine deutsche Touristin als verschwunden, vermuten ein Tötungsdelikt und verdächtigen ihren Begleiter, eben diesen Mathematiker. Dieser entpuppt sich als ein Genie, welches allerdings außerstande ist, sich ein einigermaßen normales Leben zu organisieren. Die Mühlen der Justiz beginnen sich zu drehen.
08.04.2021 10:54:47 [Deutschlandfunk Kultur]
Helge-Ulrike Hyams: „Denk ich an Moria“
(Info: Helge-Ulrike Hyams: „Denk ich an Moria: Ein Winter auf Lesbos“, Berenberg Verlag, 2021, 160 Seiten, 16 Euro) Was treibt freiwillige Helfer an, Flüchtlingen in der Not zu helfen? Wie gehen sie mit dem Druck und den Belastungen auf Körper und Seele um? Das beschreibt die 79-jährige Helferin Helge-Ulrike Hyams in ihrem Erfahrungsbericht „Denk ich an Moria“.

Vor etwas mehr als einem halben Jahr brannte auf der Insel Lesbos das Flüchtlingslager Moria ab. Auch im neuen Lager Kara Tepe sind die Verhältnisse schlecht. Wasser- und Strommangel, Kälte und Hunger, Krankheiten und psychische Leiden mit Suizidgefahr sind an der Tagesordnung.

08.04.2021 10:56:36 [Junge Welt]
Deutschland und Russland: Verschmähte Liebe
(Info: Alexander Rahr: Anmaßung. Wie Deutschland sein Ansehen bei den Russen verspielt. Das Neue Berlin, Berlin 2021, 174 Seiten, 16 Euro) Am Anfang steht eine Frage. »Was man in Deutschland über die Russen denkt, steht jeden Tag in der Zeitung. Doch was weiß man hierzulande über die Ansichten der Russen über die Deutschen?« Mit diesem Satz wird der Leser auf der Rückseite des Buches »Anmaßung. Wie Deutschland sein Ansehen bei den Russen verspielt« empfangen. Autor Alexander Rahr hat in dem schmalen Band tatsächlich eine verschlossene Tür geöffnet und vermittelt, dass es bei der hierzulande herrschenden geistigen und thematischen Armut in der Debatte über und mit Russland überhaupt nicht bleiben müsste.
08.04.2021 10:59:37 [Frankfurter Allgemeine Zeitung]
Chamäleons sind die besseren Menschen
(Info: Pierre Lemaitre: „Spiegel unseres Schmerzes“. Roman. Verlag Klett-Cotta, Stuttgart 2020. 480 S., geb., 24,– €.) Flucht ins Ungewisse: In seinem Roman „Spiegel unseres Schmerzes“ erzählt Pierre Lemaitre vom französischen Warten auf den Krieg im Jahr 1940. Die „Drôle de guerre“ (das monatelange Abwarten zwischen der französischen Kriegserklärung ans nationalsozialistische Deutschland 1939 und dessen Einmarsch in Belgien 1940) sowie die deutsche Invasion sind undankbare Themen; Frankreich war in jenem Moment nicht in Hochform. Für einen Roman darüber gilt das doppelt, wenn sein heimlicher Held ein Hochstapler vor dem Herrn ist – im Wortsinn: Er gibt vor, ein Pfarrer zu sein.
08.04.2021 11:02:04 [RT DE]
Vielfalt in der Filmbranche: Das eigentliche Problem sind die
Die Filmbranche diskutiert seit Langem, wie sich mehr Vielfalt im Film umsetzen lässt. Dazu sprachen wir mit dem Schauspieler Ercan Özçelik. Er fordert Verfahren innerhalb der deutschsprachigen Filmindustrie anzuwenden, um die Diversität zu sichern, die in Hollywood jetzt bereits angewendet werden. Herr Özçelik, in Hollywood soll es in den nächsten Jahren mehr Vielfalt vor und hinter der Kamera geben. Jedenfalls möchte die Oscar-Akademie ab dem Jahr 2024 durch neue Standards bei den Oscar-Wettbewerben für mehr Inklusion und Diversität sorgen.
08.04.2021 11:05:01 [Zeit Online]
"Kollektiv – Korruption tötet": Tödliche Gier
(Info: "Kollektiv – Korruption tötet" ist noch bis zum 26. April in der ARD Mediathek abrufbar.) Nach einem Brand in einem Bukarester Club starben 64 Menschen. Ein Dokumentarfilm zeigt die Korruption in Politik und Gesundheitswesen. Er ist für zwei Oscars nominiert. Dieser Dokumentarfilm glaubt an einen aufklärerischen, der Wahrheit verpflichteten Journalismus. Einen Journalismus, der den Kampf gegen Instanzen aufnimmt, die mächtiger sind als er selbst. Alexander Nanaus Film "Kollektiv – Korruption tötet" zeigt viel mehr als reine Fakten, weil er auch eine Wut und eine Trauer einfängt, die alle Beteiligten dazu bewegen, aktiv zu werden und zu bleiben.
08.04.2021 11:07:30 [TAZ]
US-Filmemacherin Chloé Zhao: Mit dem Vorgefundenen erzählen
(Info: „Songs My Brothers Taught Me“. Regie: Chloé Zhao. Mit John Reddy, Jashaun St. John u. a. USA 2015, 98 Min. Läuft ab 9. 4. auf Mubi) Die Regisseurin Chloé Zhao ist mit „Nomadland“ für die Oscars nominiert. Auch ihr Debüt „Songs My Brothers Taught Me“ ist sehenswert. Wenn am 25. April die Oscars verliehen werden, wird der weltweit wichtigste Filmpreis sehr anders aussehen als in den 92 Jahren zuvor. Das liegt nicht nur an der pandemiebedingt eingedampften Zeremonie und dem Kinolockdown, der den Streamingdiensten wohl einen Triumph über die klassischen Hollywoodstudios bescheren wird.
09.04.2021 10:51:21 [Zeit Online]
Dokumentation "White Cube": Das Kapital der Kunst
(Info: "White Cube" von Renzo Martens ist noch bis zum 11. April als Video-on-Demand auf der Website der Kunst-Werke Berlin zu sehen.) Es ist fast unmöglich, in Afrika der Assoziation des "white savior", also des weißen Retters oder gar Heilands, zu entkommen. Das gilt besonders dann, wenn man als Europäer kommt, um über Workshops und politisches Bewusstsein die Einheimischen zu mobilisieren.

Renzo Martens ist einer dieser Europäer, denkt man zunächst: Der niederländische Konzeptkünstler setzt das Klischee gleich an den Anfang seines neuen Films "White Cube", einer 79-minütigen Langzeitbeobachtung von Martens' Arbeit im Kongo.

09.04.2021 10:53:40 [Junge Welt]
Herumtrampeln in der Klickfarm
(Info: Tom Hillenbrand: Montecrypto. Verlag Kiepenheuer & Witsch, Köln 2021, 448 Seiten, 16 Euro) Bitcoins und Blogger: Der Thriller »Montecrypto« von Tom Hillenbrand. Heute würde Bertolt Brecht vielleicht nicht mehr fragen: »Was ist ein Überfall auf eine Bank gegen die Gründung einer Bank?«, sondern: »Was ist die Gründung einer Bank gegen die Gründung einer Währung?« Und die nächste Frage: Was passiert, wenn die digitale Schütte die ganze Welt in den Abgrund zu reißen droht?

Um genau das zu verhindern, schickt Autor Tom Hillenbrand in dem Thriller »Montecrypto« seinen Privatschnüffler Ed Dante in die Spur.

09.04.2021 10:55:25 [Der Freitag]
Streaming rettet die Branche, nicht die Musik
Während die Welt draußen weiterhin an Strömung eingebüßt hat, strömt es immer öfter daheim. Schon am Anfang dieses Jahres meldeten das Marktforschungsinstitut GfK Entertainment und der Bundesverband Musikindustrie (BVMI), dass der Marktanteil von Streamingdiensten im Musikmarkt wächst. Ganze 139 Milliarden Musikstreams wurden im Jahr 2020 gezählt, ein Drittel mehr als im Vorjahr. Florian Drücke, Chef des BVMI, sagte der dpa im Januar, dass in den ersten sechs Monaten des Jahres 2020 rund zwei Drittel des Umsatzes in der Musikindustrie aus den Streams von Spotify, YouTube, Amazon und Co. generiert wurden.
09.04.2021 10:59:06 [Spektrum]
Kann das weg?
(Info: Melanie Kröger, Jens Pape, Alexandra Wittwer (Hg.). Einfach weglassen?. Verlag: oekom, München 2020, ISBN: 9783962382438 | Preis: 26,00 €) Das informative Buch bietet einen etwas sperrigen Rundumblick um das Weglassen von Plastikverpackungen. Wer sind die Menschen, die in Unverpacktläden einkaufen? Warum ist Bioplastik keine gute Alternative? Wann entstand das negative Image von Plastikprodukten? Und warum ist Littering so wenig erforscht? In 21 Beiträgen berichten 35 Autoren über aktuelle Studien zum Vermeiden von Plastik, insbesondere von Verpackungen.
09.04.2021 11:02:08 [NachDenkSeiten]
Wie Ideologen bestimmen, was gut und böse ist
(Info: Judith Sevinç Basad: „Schäm dich! Wie Ideologen bestimmen, was gut und böse ist“, 224 Seiten, Westend Verlag, 29.3.2021) Judith Sevinç Basad empört sich – und stemmt sich vehement gegen die sich aufgeklärt wähnende Meinungsmache, gegen Denkverbote und Unschärfen in den Argumenten einer selbsternannten kulturellen Elite. Ist es denn, genau betrachtet, wirklich so, dass die „Privilegierten“ den sozialen Aufstieg von Migrantenkindern verhindern? Kann es sein, dass eine selbsternannte Elite bestimmt, wie sich unsere Sprache entwickelt und welche Filme wir sehen dürfen? Ist es im Kampf gegen Rassismus mit der Entmachtung des „alten weißen Mannes“ getan?
09.04.2021 11:05:54 [Big Business Crime]
Die Schattenwelt der extremen Ausbeutung
(Info: Kathrin Birner/Stefan Dietl: Die modernen Wanderarbeiter. Arbeitsmigranten im Kampf um ihre Rechte, Unrast-Verlag, Münster, 2021, 139 Seiten, 12,80 Euro, ISBN 978-3-89771-299-7) „Die Ökonomie der Werkverträge und Subunternehmen spielt im postmodernen Kapitalismus eine zentrale Rolle.“ So sehr die deutsche Wirtschaft auf die innereuropäischen Wanderarbeiter angewiesen ist, so wenig sind deren prekäre Lebens- und Arbeitsbedingungen öffentlich sichtbar. Anliegen der beiden Autoren Kathrin Birner und Stefan Dietl ist es, über die extreme Ausbeutung der Menschen aufzuklären, die vorübergehend ihre Heimatländer verlassen, um in Deutschland zu arbeiten.
10.04.2021 10:50:48 [Deutschlandfunk Kultur]
Trauer um einen charismatischen Künstler
Der Tänzer und Choreograf Ismael Ivo ist mit nur 66 Jahren an Covid-19 gestorben. Ivo hat mit den wichtigsten Protagonisten des modernen und zeitgenössischen Tanzes zusammengearbeitet, 1984 das wichtigste europäische Tanzfestival „ImPulsTanz – Vienna International Dance Festival“ mitbegründet.

Karl Regensburger hat Ismael Ivo in den 80er Jahren nach Wien geholt, ist dort bis heute Intendant des Festivals und wurde nun auch von der Todesnachricht aus São Paulo überrascht.

10.04.2021 10:53:52 [Süddeutsche Zeitung]
Zum Tod von Rapper DMX: Harter Hund
Mit geschundener Seele. DMX war einer der erfolgreichsten Rapper seiner Zeit. Und einer der härtesten. Einerseits. Ende der 90er-Jahre war plötzlich wieder viel Platz auf der Straße. Tupac Shakur: tot. 1996 erschossen nachdem er in Las Vegas einen Boxkampf besucht hatte. Ein halbes Jahr später starb Christopher Wallace, besser bekannt als The Notorious B.I.G. - Drive-By-Shooting. Womöglich Vergeltung, man vermutete Wallace hinter dem Mord an Shakur. Resultat des jahrelangen Beefs zwischen den beiden. Die 90er waren eine Zeit, in der Gangsta-Rap noch nicht aus Bietigheim-Bissingen kam. East-Coast vs. West-Coast, man hat das vor allem hierzulande ein bisschen verdrängt, das war noch sehr echte Gewalt.
10.04.2021 10:56:36 [Junge Welt]
Westdeutsche Arbeiterbewegung: Auf Kampfmittel verzichtet
Geschichte: Nicht wenig, nicht genug: 70 Jahre Montanmitbestimmung. Am 10. April vom Bundestag verabschiedet, wurde das Gesetz über die Mitbestimmung in der Montanindustrie am 21. Mai 1951 erlassen. Es ist von allen Mitbestimmungsgesetzen in Deutschland das weitreichendste und gestattet den »Arbeiternehmern« in Betrieben des Bergbaus und der Schwerindustrie mit über tausend Mitarbeitern eine vollständige Parität im Aufsichtsrat. Die Hälfte der Aufsichtsratsmitglieder ist mit Gewerkschaftern und »Arbeitnehmervertretern« zu besetzen. Zu diesen zählt, anders als in anderen »Mitbestimmungsgesetzen«, nicht zwangsläufig die Gruppe der »leitenden Angestellten«.