Net News Express

 
       
   
 Kategorien:
Topthemen (7)
Aktuelle Themen (6)

Frei lassen für wichtige Themen (0)

Wirtschaft, Ökonomie, Finanzen, Finanz- und Wirtschaftskrise, Geldsystem, Währung, Banken (6)

Medien, Journalismus, Propaganda, Zensur, Netzpolitik, Internet, Computer, IT, Digitalisierung (5)

Konzerne, Unternehmen, Monopole, Organisationen, Vereine, Lobbyismus, Korruption (0)

Überwachung, Daten, Geheimdienste, Spionage, Macht & Kontrolle, Totalitarismus, Sicherheit (3)

Krieg, Kriegsverbrechen, Frieden, Terrorismus, Rüstung, Militär, NATO (11)

Katastrophen, Unglücksfälle (0)

Deutschland (5)

Europa, Brüssel, EU, Europäische Union (3)

International (6)

Politik, Verfassung, Grundgesetz, Menschenrechte, Parteien, Wahlen, Demokratie, Recht, Gesetz und Justiz (1)

Arbeit, Gewerkschaft, Rente, Soziales, Gesellschaft, Alltag, Bildung (4)

Umwelt, Ökologie, Verkehr, Tiere, Agrarpolitik/-wirtschaft, Klima, Energie, Atomkraft, Oel, Rohstoffe, Gentechnik, Konsum, Verbraucher (7)

Ansichtssache, Meinung, Kommentare, Diskussion, Debatte, Hintergrund, Verschiedenes (9)

Widerstand, Revolution, Unruhen, Protest, Demos, Streiks (0)

Wissenschaft, Technik, Technologie, Digitalisierung, Künstliche Intelligenz, Zukunft, Forschung, Weltraum, Astronomie (0)

Gesundheit, Gesundheitswesen, Gesundheitspolitik, Medizin, Ernährung (7)

Feuilleton: Kultur, Geschichte, Literatur, TV, Fernsehen, Film, Musik, Games (6)

Sport (7)

Kirchen, Religionen, Esoterik, Grenzwissenschaften und Übersinnliches (0)

Termine, Veranstaltungen, Aktionen, Petitionen, Alternative Projekte (0)

Satire, Humor, Kolumne, Glosse, Kurzgeschichten (0)
 Arbeit, Gewerkschaft, Rente, Soziales, Gesellschaft, Alltag, Bildung (56)
01.09.2021 06:24:44 [Neues Deutschland]
Arbeitsmarkt: Nach dem Absturz
Hartz IV muss weg - darüber herrscht vor der Bundestagswahl grün-rot Einigkeit. Konkret fordern die drei Parteien mehr oder weniger radikale Änderungen, die jedenfalls alle zugunsten der Hilfebedürftigen gehen. So wollen Linke und Grüne eine sanktionsfreie Mindestsicherung, die SPD will nur »unwürdige« Kürzungen abschaffen. Ein Vorschlag, den sie schon 2019 präsentiert hat, ist in der Pandemie befristet beschlossen worden: Neuen Arbeitslosengeld-II-Empfängern werden die tatsächlichen Wohnkosten erstattet. Verbal hat die SPD Hartz IV komplett entsorgt: In ihrem Wahlprogramm taucht das Wort nicht auf.
01.09.2021 11:06:11 [Golem]
#ausgeliefert: Amazon soll Lieferfahrer fest einstellen
Die Gewerkschaften und Beratungsnetzwerke fordern Amazon auf, seine Zusteller fest einzustellen. Das gab die Dienstleistungsgewerkschaft Verdi am 31. August 2021 bekannt. Uwe Speckenwirth, Fachbereichsleiter Speditionen und Logistik bei Verdi Nordrhein-Westfalen, sagte: "Nicht erst seit der Pandemie boomt der Online-Handel. Amazon ist als weltgrößter Online-Händler einer der Profiteure und konnte den Gewinn verdreifachen - auf dem Rücken der Beschäftigten, die die Pakete ans Ziel bringen." Im Rahmen von bundesweiten Aktionstagen vom 1. bis 4. September 2021 soll auf die Situation der Fahrer aufmerksam gemacht werden.
01.09.2021 11:08:21 [Der Freitag]
Arbeitsmarkt: Nicht mehr erpressbar
Weltweit gleichen sich die Löhne an, die Drohung mit Globalisierung taugt nicht mehr zur Einschüchterung von Beschäftigten. Grundlage allen Wirtschaftens ist die Arbeit. Es lohnt, sich das Einfache in Erinnerung zu rufen, bevor wir das Komplexe, Globale in den Blick nehmen. So funktioniert das Gesellschaftssystem, in dem wir leben: Es beruht auf Arbeit. Das gilt für alle gesellschaftlichen Bereiche und damit auch für die Unternehmen. Ohne die Arbeit der abhängig Beschäftigten gibt es für Unternehmen keine Gewinne. Im marktwirtschaftlich-kapitalistischen System sind Renditen und Gewinne aber offenbar Teil einer Art Gesellschaftsvertrag. Wenn die Löhne steigen, schrumpfen die Renditen: Doch hier kennt das System keinen Humor.
01.09.2021 12:30:33 [Neues Deutschland]
Streik der GDL: Entschlossene Lokführer
Die Ansage der Gewerkschaft Deutscher Lokomotivführer (GDL) an die Deutsche Bahn ist unmissverständlich: Streik. Der dann bereits dritte in der derzeit laufenden Tarifauseinandersetzung. Und der längste. Im Güterverkehr beginnt der Ausstand laut GDL an diesem Mittwoch um 17 Uhr. Im Personenverkehr und der Infrastruktur, auf deren Beschäftigte die Gewerkschaft ihre Organisierungsbemühungen auch im Hinblick auf die konkurrierende Eisenbahn- und Verkehrsgewerkschaft (EVG) mittlerweile ausgeweitet hat, wird die Arbeit ab Donnerstag 2 Uhr niedergelegt.
01.09.2021 12:40:59 [Der Freitag]
Arbeitskampf: Jetzt ist Zahltag
Die Wirtschaft erholt sich, Personal wird knapp. Beschäftigte haben die besten Aussichten seit Langem, höhere Löhne und bessere Bedingungen zu erreichen. Silvia Habekost ist Anästhesieschwester, sie spricht ruhig und freundlich. Doch was sie sagt, ist echter Sprengstoff. „Entweder sie nehmen zumindest Verhandlungen auf oder wir werden noch vor den Wahlen in den Streik treten.“ Habekost arbeitet im Vivantes-Klinikum Berlin-Friedrichshain. Das ist nicht bloß verbales Säbelrasseln, wie es Gewerkschaften öfters vor Tarifrunden absondern. Sondern ein Anzeichen, dass sich auf dem Arbeitsmarkt gerade etwas grundlegend verändert.
01.09.2021 17:59:47 [Gegen Hartz]
Hartz IV-Bezieher werden aus teuren Wohngegenden verdrängt
Immer weniger Betroffene von Sozialleistungen können sich Wohnungen in Küstenorten leisten, weil die Mieten zu stark steigen und die Jobcenter häufig falsche Bemessungen der „Angemessenheit“ der Kosten der Unterkunft vornehmen. Das berichtet der NDR aus Schleswig-Holstein. In vielen Städten gibt es historisch gewachsene Arbeiterviertel, in denen oftmals bis heute weniger Wohlhabende leben. Insbesondere in touristischen Regionen gibt es jedoch innerhalb eines Vergleichsraums häufig punktuell sehr teure Mieten, während am Stadtrand oder in einer umliegenden Gemeinde die Wohnkosten vergleichsweise niedrig sind. So kommt es zu einer Armutswanderung.
06.09.2021 07:08:02 [Aktuelle Sozialpolitik]
Mit Job, aber ohne eigene Wohnung
Wir laufen nun schon zügig in den Herbst rein, die Tage und vor allem die Nächte werden wieder kälter – und wenn erst der Winter vor der Tür steht, dann wird es wieder Berichte über die Not obdachloser Menschen geben.

Die waren und sind aber auch an den anderen Tagen ohne Wohnung oder irgendwo untergekommen. Und darunter sind auch Menschen, die viele sicher nicht mit Obdachlosigkeit, von dem man ein bestimmtes (Stadt)Bild im Kopf hat, verbinden werden. Menschen, die einen Job haben. Zur Arbeit gehen. Und dann eben nicht „nach Hause“, wie das bei Millionen anderen der Fall ist.

06.09.2021 07:38:14 [Aktuelle Sozialpolitik]
Kinderfreizeitbonus
Es kann jedem von uns bei ehrlicher Arbeit passieren, dass man was vergisst, dass man unbeabsichtigt Fehler macht, dass man unter Zeitdruck das eine oder andere schleifen lässt und hinterher erkennen muss, dass man hätte anders handeln sollen.

So ist das auch bei der Gesetzgebungstechnik. Die vielen handwerklichen Fehler, die man als langjähriger Beobachter und Begleiter der dahinter stehenden Maschinerie in gefühlt zunehmenden Maße zur Kenntnis nehmen muss, betreffen nun aber nicht irgendwelche Außenseiter oder Einzelfälle, sondern oftmals geht es – gerade im sozialpolitischen Bereich – um (Nicht-)Leistungen für sehr viele Menschen.

06.09.2021 11:23:19 [Aktuelle Sozialpolitik]
Kurzarbeit im Sommerloch
Im vergangenen, dem ersten Corona-Jahr, waren mal 6 Millionen Beschäftigte in Kurzarbeit. Immer Sommer 2020 ging die Zahl dann deutlich zurück, um während der zweiten Welle im Winter wieder anzusteigen. Für den August 2021 berichtet nun das ifo Institut für Wirtschaftsforschung von einem deutlichen Rückgang: von 1,06 Millionen auf 688.000 Menschen. Das sind 2,0 Prozent der abhängig Beschäftigten, die sich noch in Kurzarbeit befinden, nach 3,2 Prozent im Juli 2021. Einzig das Gastgewerbe hatte im August noch 10,1 Prozent Kurzarbeit, was 107.000 Menschen entspricht. Allerdings ging die Zahl auch hier erheblich zurück, denn im Vormonat betrug der Wert noch 17,1 Prozent.
06.09.2021 17:20:56 [Junge Welt]
Billiglohnland Thüringen
Tarifverträge machen einen Unterschied. Je nach Branche verdienen die Beschäftigten bis zu 50 Prozent mehr. Die Differenz kann bis zu 1.200 Euro brutto im Monat ausmachen.

Die Bundestagsabgeordnete Beate Müller-Gemmeke (Bündnis 90/ Die Grünen) hat die Zahlen bei der Bundesregierung abgefragt. Es sei dramatisch, dass nur noch die Hälfte der Beschäftigten zu tariflichen Bedingungen arbeite, berichtete dpa am Sonntag. Die Regierungsparteien hätten diese Situation ignoriert. »Gerade in Branchen wie dem Einzelhandel, in denen sich Unternehmen der Tarifbindung entziehen, brauchen wir erleichterte Regeln, damit Tarifverträge einfacher allgemeinverbindlich erklärt werden können und für alle in der Branche gelten«, forderte sie.

06.09.2021 19:08:15 [Blätter]
Jubiläum im Allzeittief: 50 Jahre BAföG
Es war ein Meilenstein der Bildungspolitik und eine entscheidende Voraussetzung für die soziale Öffnung der Hochschulen: Vor fünfzig Jahren – am 1. September 1971 – verabschiedete die damalige sozialliberale Koalition das Bundesausbildungsförderungsgesetz (BAföG). Es sollte dazu beitragen, dass über den Zugang zu höherer Bildung nicht länger das Portemonnaie der Eltern entscheidet, sondern nur noch „Neigung, Eignung und Leistung“ (§ 1 BAföG). Der Effekt war zunächst vielversprechend: Zu Beginn, vor einem halben Jahrhundert, wurden rund 45 Prozent aller Studierenden gefördert – und zwar mit einem Vollzuschuss, der nicht zurückgezahlt werden musste.
07.09.2021 06:55:58 [Kontext Wochenzeitung]
Vera Sompon: Die Wut in mir
Vera Sompon steht schon in der Tür und empfängt uns herzlich, als wir die letzten Stufen der langen Treppe zu ihrem Büro in der Göppinger Innenstadt erklimmen. Im Eingangsbereich hängen gerahmte Fotos von großen Vorbildern. Zur Inspiration, sagt sie. Nelson Mandela mit kämpferisch erhobener Faust. Oder Rosa Parks, die 1955 in den USA wegen ihrer Weigerung, Weißen im Bus ihren Platz zu räumen, verhaftet wurde, was jene Proteste auslöste, die zum Ende der Rassentrennung führten. Vera Sompon ist Gründerin, Beraterin und Geschäftsführerin des gemeinnützigen Vereins Sompon Socialservice, der sich um Migranten vor allem afrikanischer Herkunft kümmert.


07.09.2021 09:36:27 [WSWS]
Eisenbahner bereit zum unbefristeten Streik
Bis zum heutigen Dienstag, frühmorgens um 02:00 Uhr, hat der jüngste Bahnstreik im Tarifkampf der Gewerkschaft Deutscher Lokführer (GDL) gedauert. Es war in dieser Auseinandersetzung mit 120 Stunden der bisher längste Streik, der erstmals auch über ein Wochenende andauerte.

Neben Lokführern und Zugbegleitern streikten Handwerker der Werkstätten, Fahrdienstleiter, Servicemitarbeiter, Instandhalter und Bordgastronomen – im Ganzen über 10.000 Eisenbahner, wie GDL-Chef Weselsky in Berlin erklärte. Selbst die Deutsche Bahn räumte offiziell ein, dass sich deutlich mehr Lokführer als bisher am Streik beteiligt hätten.

07.09.2021 09:45:30 [Aktuelle Sozialpolitik]
Nächste Ausfahrt unbefristeter Pflegestreik?
Viele reden über die Notwendigkeit, dass es zu einem Pflegestreik kommen müsse, damit sich wirklich mal was ändert – und das schon seit vielen Jahren. Allerdings ist das leichter dahingesagt als organisiert. Es gibt viele Hürden, die genommen werden müssten. Das kann man wie in einem Lehrbuch live in Berlin studieren. Dort gab es nach einem im Mai 2021 gestellten 100 Tage-Ultimatum, das man offensichtlich nicht ernst genommen hat, eine erste Warnstreikaktion – und bereits die sollte auf arbeitsgerichtlichen Wege verhindert werden, was letztendlich aber gescheitert ist.
07.09.2021 11:38:11 [Junge Welt]
Gewerkschaften: Gemeinsam gegen Tarifeinheit
Der Streik der Lokführergewerkschaft GDL wirkt: Das Land diskutiert über eine Tarifauseinandersetzung, die kämpferisch ausgetragen wird. Längst geht es um mehr als die Höhe des Lohnes – auch das Tarifeinheitsgesetz steht zunehmend in der Kritik. Und der Wirtschaftsflügel der Christdemokraten nutzt die Gelegenheit, um das Streikrecht vieler Berufsgruppen anzugreifen.

Am Wochenende war ein Beschluss des Vorstandes der Mittelstands- und Wirtschaftsunion von CDU und CSU bekanntgeworden. Anlässlich des Lokführerstreiks fordert er in dem Papier strengere Vorgaben für Arbeitskämpfe im Zug- und Luftverkehr.

07.09.2021 15:19:38 [Tichys Einblick]
Wie aus Bildung Indoktrination wird
Die unter Schülern in der DDR berüchtigte "Staatsbürgerkunde" kehrt zurück – nicht als eigenes Schulfach, sondern unausgesprochen und fächerübergreifend. Der kritische, mündige Bürger ist für die heutigen "Interpretationseliten" nicht mehr das Bildungsziel. Am 4. November 1989 forderte die Schauspielerin Steffi Spira auf der großen Demonstration in Ostberlin im Rahmen der Friedlichen Revolution: „Nie wieder Staatsbürgerkunde!“ Ihr Wunsch hat sich nicht erfüllt, das Fach ist zurück als fächerübergreifender Konstruktivismus im Geist totalitärer Ideologie, wie der Kommunismus dank der westdeutschen Linken und Linksliberalen und des Versagens von CDU/CSU zurück ist, diesmal in Gestalt der klimaneutralen Gesellschaft.
07.09.2021 17:11:40 [BIAJ]
Hartz IV (SGB II): Bundesregierung verabschiedet sich mit Mittelkürzung und realer Leistungskürzung
Im Regierungsentwurf des Bundeshaushalts 2022 („Federführend ist das Bundesministerium der Finanzen.“) sind für „Leistungen der Grundsicherung für Arbeitsuchende“ insgesamt 42,4 Milliarden Euro veranschlagt (Soll), 2,6 Milliarden Euro weniger als im Bundeshaushalt 2021 (Soll 2021: 45,0 Milliarden Euro).
Für „Leistungen zur Eingliederung in Arbeit“ wurden 200 Millionen Euro weniger, für die „Beteiligung des Bundes an Leistungen für Unterkunft und Heizung“ (einschließlich der „Leistungen für Bildung und Teilhabe“ nach § 28 SGB II) wurden 1,1 Milliarden Euro weniger, und für das „Arbeitslosengeld II“ (einschließlich Sozialgeld) wurden 1,3 Milliarden Euro weniger veranschlagt als im Bundeshaushalt 2021.

07.09.2021 18:48:35 [Junge Welt]
Pflegenotstand: Mehrheit für Arbeitskampf
Die Streikbereitschaft ist enorm: Mehr als 98 Prozent der in Verdi organisierten Beschäftigten der Berliner Krankenhäuser Vivantes und Charité haben in einer Urabstimmung für einen unbefristeten Arbeitskampf gestimmt. Voraussichtlich solle schon ab Donnerstag gestreikt werden, sagte Meike Jäger, Leiterin des Verdi-Fachbereichs Gesundheit und Soziales in Berlin und Brandenburg, bei der Vorstellung der Ergebnisse in einer Pressekonferenz am Montag. Sie kündigte an, der Streik solle andauern, bis ein Ergebnis vorliege. Man sei zu einem »Erzwingungsstreik« bereit und rechne mit bis zu 2.000 Beschäftigten, die die Arbeit niederlegen.
08.09.2021 06:56:24 [Augsburger Allgemeine]
Wie der Staat Lehrer in die Arbeitslosigkeit schickt
Es ist ein Muster, das sich Jahr für Jahr wiederholt: Kaum haben die Sommerferien begonnen, steigen die Zahlen in der Arbeitslosenstatistik: Tausende Lehrer ohne feste Anstellung, die während des Schuljahres für einen reibungslosen Ablauf des Unterrichts sorgen, müssen sich für mindestens sechs Wochen arbeitslos melden. Danach werden ihre Verträge verlängert, manchmal sogar an der gleichen Schule. Jedes Jahr wird diese Praxis von den Gewerkschaften lautstark kritisiert – doch eine Änderung ist trotz Corona nicht in Sicht.
08.09.2021 11:38:01 [Aktuelle Sozialpolitik]
Arbeitslose in Österreich
Man kennt das seit vielen vielen Jahren in Deutschland. In einer wellenförmigen Bewegung wird immer wieder ein bewusst-unbewusstes Narrativ aufgerufen: Viele Arbeitslose sind schlichtweg selbst schuld an ihrer Situation, weil sie sich „drücken“, weil sie sich eingerichtet haben in den „großzügigen“ Transferzahlungen, weil es ihnen „zu gut“ gehen würde. Die Individualisierung, Personalisierung und Moralisierung von Arbeitslosigkeit hat sich seit den 1990er Jahren flächendeckend durchgesetzt und ist in vielen Köpfen tief verankert. Und man instrumentalisiert dann gerne das Reden vom „Missbrauch“ und der Verweigerung des Zumutbaren in den Situationen, in denen man Leistungen kürzen will. Was man ja irgendwie rechtfertigen muss.
08.09.2021 13:48:20 [ScienceFiles]
Ausgerechnet Hochschulen werden zu Exekutoren der Apartheid
Eigentlich sollte man sich nicht darüber wundern, dass Hochschulen einmal mehr zu ideologischen Vehikeln umfunktioniert werden, die staatsdienlich und regimetreu genau das umsetzen, was ihnen vorgegeben wird. Das hat zwar weder mit Wissenschaft zu tun noch wird es dazu führen, dass deutsche Hochschulen, teure Hochschulen, von Steuerzahlern finanzierte, von allen, auch ungeimpften Steuerzahlern finanzierte Hochschulen in Zukunft dem gesellschaftlichen Auftrag gerecht werden können, den sie haben: nützliches Wissen, produktiv einsetzbares Wissen, den Lebensstandard der Bevölkerung erhöhendes Wissen zu produzieren, aber es ist eben nicht verwunderlich.
08.09.2021 13:56:01 [Junge Welt]
Konkurrenz der Bahngewerkschaften: Eskalation per Gesetz
Es gehe ihr nur darum, Mitglieder zu rekrutieren. Diesen Vorwurf muss sich so ziemlich jede streikende Gewerkschaft von den »Arbeitgebern« und ihren Claqueuren anhören. Im Falle der Gewerkschaft Deutscher Lokomotivführer (GDL), die den zweitlängsten Streik der Bahn-Geschichte in der Nacht zum Dienstag planmäßig beendete, kommt die Anschuldigung allerdings auch vom Vorsitzenden des Deutschen Gewerkschaftsbundes (DGB), Reiner Hoffmann, der in der Rheinischen Post behauptete, GDL-Chef Claus Weselsky gehe es im »Kern« darum, »seine Gewerkschaft – die zum Deutschen Beamtenbund DBB gehört – zu erhalten und ihren Einflussbereich zu vergrößern, um auf diese Weise mehr Mitglieder zu gewinnen«.
08.09.2021 15:30:00 [Multipolar]
Menschenrecht Bildung nur für Geimpfte?
Was passiert momentan mit unserer so hoch gepriesenen Bildung, unserem deutschen Bildungssystem, mit der Generation und den Nachfolgenden, die studieren, sich bilden wollen? Artikel 5 des deutschen Grundgesetzes garantiert: „Kunst und Wissenschaft, Forschung und Lehre sind frei. Die Freiheit der Lehre entbindet nicht von der Treue zur Verfassung.“ Wo aber ist die Verfassung, wo sind die Verfassungsrechtler, wenn es um die 3G-Regel geht? Sie ducken sich weg, sind plötzlich nicht mehr zuständig.

Für ungeimpfte Studenten bedeutet 3G, ab 11. Oktober 2021 jeden Tag einen Test aus eigener Tasche zu zahlen.

09.09.2021 07:01:40 [Untergrund-Blättle]
Wie Arbeitsmigranten aus “dem Osten” Europa am Laufen halten
Während die EU ihre Aussengrenzen mit roher Gewalt markiert, sollen im Innern Freizügigkeit und Arbeitsverhältnisse gesichert sein – selbstverständlich nur für Leute mit einem EU-Pass. Der Neoliberalismus stützt sich stark auf flexible, sozial unsichtbar gemachte, migrantische Arbeit – billig, oft illegalisiert und unter harten Bedingungen ausgeführt. Diese Muster der transnationalen Arbeit werden durch einen ständigen Fluss von Menschen, die Umgestaltung von Produktionsstandorten, undurchsichtige Investitionsverträge, Eigentumsverhältnisse und Arbeitsvorschriften geformt.
09.09.2021 07:06:57 [Gegen Hartz]
Soziale Spaltung im Alter: Geringverdiener sterben früher
Je höher die Arbeitsbelastung und je niedriger der Verdienst, desto geringer ist die Lebenserwartung. Das zeigt eine durch den Sozialverband VdK in Auftrag gegebene Studie des Deutschen Instituts für Wirtschaftsforschung. Der Verband warnt daher vor einer zunehmenden sozialen Spaltung durch Erhöhung des Renteneintrittsalters und fehlende Mindestrenten. Der Befund der DIW-Studie im Auftrag des VdK ist wenig überraschend. Geringverdiener in harten Jobs bekommen weniger Rente und eine geringere Lebenserwartung als beispielsweise Beamte.
09.09.2021 07:11:09 [Neues Deutschland]
Bildungsungleichheit in der Pandemie
Wie sich während der Coronakrise die soziale Polarisierung in der jungen Generation verstärkt hat. Als die Covid-19-Pandemie im Februar/März 2020 die Bundesrepublik erreichte, deckte sie einerseits viele schon länger bestehende Missstände, soziale Ungleichheiten und politische Versäumnisse auf. Andererseits hat sich die Ungleichheit in Deutschland weiter verschärft: durch die »Jahrhundertpandemie«, durch das von ihren ökonomischen Auswirkungen (Unterbrechung von Lieferketten und Zusammenbruch von Absatzmärkten) sowie den staatlichen Infektionsschutzmaßnahmen (temporäre Schließung von Gaststätten, Geschäften und Kultureinrichtungen sowie Kontaktverbote, Ausgangs- und Reisebeschränkungen) ausgelöste Krisendesaster.
09.09.2021 09:16:40 [Süddeutsche Zeitung]
Hartz IV: Die Mär vom gierigen Arbeitslosen
Die Gesellschaft sollte mehr Empathie gegenüber erwerbslosen Menschen zeigen - auch im eigenen Interesse. Das Bild des Hartz-IV-Empfängers wurde wahrscheinlich von keiner einzelnen Person so sehr geprägt wie von Arno Dübel. Der Langzeitarbeitslose tingelte während der 2000er-Jahre durch deutsche Talkshows, wo er entsetzten Gesprächspartnern erklärte, dass er sich mit staatlicher Grundsicherung sehr wohlfühle. Wenn es einen lebenden Beweis dafür brauchte, dass die Schröderschen Hartz-Reformen längst überfällig gewesen waren, Arno Dübel stand parat. Noch 2010 titelte die "Bild"-Zeitung: "Deutschlands frechster Arbeitsloser - so gammelt er sich durch den Tag".
09.09.2021 11:28:18 [Kontext Wochenzeitung]
Tarifkampf: Schlechtes Klima bei Autozulieferer
Sie könnten Geschichte schreiben: Die Dräxlmaier-Beschäftigten in Sachsenheim bei Ludwigsburg fordern einen Tarifvertrag. Das ist ein Novum in einem Konzern, dessen Eigentümerfamilie sich bislang vehement gegen derartiges Teufelszeug wehrt. Eine Handvoll roter Fahnen, ein Transparent, eine Lautsprecheranlage für Rap und Rede, dazu ein rotes Bengalo – fertig ist die Kundgebung zum Warnstreik. Um die 60 Männer und Frauen stehen auf der Rückseite der grauen Dräxlmaierhalle im Gewerbegebiet Segro am Rande von Sachsenheim. Sie haben ihre Frühschicht an diesem Freitagmittag schon um 12 statt um 14 Uhr beendet.
09.09.2021 15:26:12 [Junge Welt]
Soziale Verelendung: Armutsregime abschaffen
Sie wollen präsent sein: Erwerbslose und Unterstützer ziehen seit Montag vor Jobcenter, organisieren Infostände in Innenstädten und verteilen Flugblätter in Wohngebieten. Ihr Motto: »Ein besseres Leben für alle – statt wachsender Armut und Ausgrenzung!« Es ist eine überregionale Aktionswoche des Bündnisses »Auf Recht bestehen«. Bis Sonntag gehen in rund 20 Städten Veranstaltungen über die Bühne. Das Ziel: »Wir wollen das ›System Hartz IV‹ samt Sanktionsapparat abschaffen«, sagte Rainer Timmermann vom Bündnismitglied Koordinationsstelle gewerkschaftlicher Erwerbslosengruppen (KOS) am Mittwoch im jW-Gespräch.
09.09.2021 15:34:00 [Brave New Europe]
UK: Ocado Zoom riders set to strike
UK delivery workers at online retailer Ocado have voted for escalating action of protests and strikes, as the company refuses to engage with the union over anger about outsourcing and poverty wages.

The Ocado Zoom ‘riders’, who are represented by the IWGB union, voted by a majority to launch the campaign against the company, which had previously promised workers £14 an hour, but under a new sub-contractor, Ryde, have seen their earnings fall by 50-70%, often less than the legal minimum wage. They are hired by Ryde on an ‘independent contractor’ basis.

09.09.2021 18:49:05 [Der Freitag]
„Den Streikmuskel trainieren“
Die „Berliner Krankenhausbewegung“ kämpft für mehr Pflegepersonal. Wir haben mit einer Krankenschwester, einer Organizerin und einem Gewerkschaftssekretär gesprochen. Der Freitag: Frau Habekost, was ist die „Berliner Krankenhausbewegung“? Und was sind Ihre Forderungen?

Silvia Habekost: Wir sind Krankenhausbeschäftigte von Vivantes und Charité. Vivantes und Charité haben die meisten Covid-19-Patienten in Berlin behandelt, aber die Personalsituation ist seit Jahren völlig unzureichend. Trotz Pandemie wurde daran nichts geändert. Ein Ziel unserer Kampagne ist also, eine feste Personal-Patienten-Quote, einen Belastungsausgleich und bessere Ausbildungsbedingungen zu bekommen – geregelt in einem „Tarifvertrag Entlastung“.

10.09.2021 06:40:19 [Gegenblende]
Kinderarmut beginnt mit niedrigen Löhnen
Soziale Ungleichheit bei Kindern erwächst aus einer Ungleichverteilung der Ressourcen von Haushalten mit Kindern, die maßgeblich vom Erwerbseinkommen der Eltern(teile) bestimmt wird. Da Kinderarmut fast immer auf Elternarmut zurückzuführen ist, die aus einer exkludierten oder Randstellung am Arbeitsmarkt resultiert, konzentrieren sich Erfolg versprechende Gegenstrategien auf Maßnahmen, welche nicht armutsfeste Löhne und Gehälter so anheben, dass man "von Arbeit wieder leben" und eine Familie mit seinem Einkommen unterhalten, fördern und sozial absichern kann.
10.09.2021 06:47:38 [Gegen Hartz]
Hartz IV: Armutsforscher fordert Maßnahmen gegen Kinderarmut
In Deutschland sind 16 Prozent der bevölkerung von Armut betroffen. Zwei von 13,5 Millionen Kinder sind von Hartz IV betroffen. Über die letzten Jahrzehnte sei eine deutliche Verschlechterung der Situation von Kindern zu beobachten, so Butterwegge in einem Interview in der Augsburger Allgemeinen Zeitung.

Zwar genieße Kinderarmut eine gewisse mediale Aufmerksamkeit, doch die Maßnahmen der Politik, diese Armut einzugrenzen, seien viel zu gering oder unwirksam. Insbesondere Alleinerziehende und ihre Kinder sind massiv von Armut betroffen.

11.09.2021 06:56:45 [TAZ]
Die Studentin an deiner Seite
Das Mentoringprogramm Rock Your Life! möchte soziale Ungleichheit an Schulen abbauen. Dies gelingt mit erstaunlichem Erfolg. So klare Vorstellungen von ihrer Zukunft haben nur wenige 14-Jährige. Panar Kokoy weiß nicht nur, dass sie Kriminalkommissarin werden möchte. Sie weiß auch, wie sie es anstellen muss, damit aus dem Traum Wirklichkeit wird.

Zunächst muss sie dieses Jahr ihren mittleren Schulabschluss machen, dann das Vorbereitungsjahr für die gymnasiale Oberstufe. Wenn sie ihr Abi in der Tasche hat, kann sie sich für ein duales Studium zur Kriminalkommissarin bewerben.

11.09.2021 07:11:54 [Perspektive]
Die Ausbeutung osteuropäischer Arbeiter hat System
Das Heizkraftwerk Süd in München wird umgebaut – hauptsächlich von osteuropäischen Arbeitern. Diese verdienen allerdings nur knapp die Hälfte von dem, was ihre deutschen Kollegen bekommen. Ein Beispiel für die systematische Ausbeutung von migrantischen Arbeitern.

In München protestieren Arbeiter der Stadtwerke München (SWM) – größtenteils Osteuropäer. Sie arbeiten gerade am Umbau des Heizkraftwerkes Süd, bereits seit April wird dort an der Isar eine neue Turbine eingebaut. Früher wurden dort Kohle und Müll verbrannt, nun soll dort Deutschlands größte Geothermie-Anlage entstehen.

11.09.2021 09:57:08 [Telepolis]
Die Furie des Verschwindens
Gesellschaft: Über die Bedeutung von Bücherorten für das soziale Immunsystem der Stadt. Es ist eine Erfahrung, die wir immer häufiger machen: Man dreht etwas kurz den Rücken zu und wenn man sich wieder rumdreht, ist es verschwunden. War da nicht neulich noch ein Papiergeschäft, dort ein Blumenladen? Standen da vor kurzem nicht noch Bäume?

Unsere Lebenswelt ist in einem Wandel begriffen, dessen Tempo stetig zunimmt und bei dem immer mehr Menschen das Gefühl haben, nicht mehr mitzukommen. Vor drei Jahren verschwand das letzte und einzige Antiquariat der Universitätsstadt Gießen.

12.09.2021 07:07:55 [TAZ]
Wenn die Zukunft verbaut wird
Armut und schlechte Bildungschancen hängen eng zusammen. Ein Bericht über die bildungsferne Kindheit und den heutigen Job im Jugendgefängnis: Als ich in der Grundschule war, zog bei uns gegenüber eine neue Familie ein. Das Mädchen, nennen wir sie Bianca, war ungefähr so alt wie ich – klare Sache, dass wir uns sofort anfreundeten. Biancas Mutter hatte sie mit siebzehn bekommen, arbeitete bei Aldi an der Kasse und war sowohl mit Argusaugen als auch mit gelegentlichen Ohrfeigen hinterher, dass Bianca auch bloß in der Schule mitkam. Auf den ersten Blick hatten wir exakt die gleichen Chancen, eine hoffnungsvolle Karriere (was immer das sein mag) hinzulegen oder krachend zu scheitern.
12.09.2021 07:13:34 [Gegen Hartz]
Hartz IV: Hunderttausend gehen beim Kinderfreizeitbonus leer aus
Einen Anspruch auf den Kinderfreizeitbonus haben zum Beispiel Kinder, die Wohngeld oder Sozialleistungen nach dem SGB II/XII (Hartz IV) oder dem Bundesversorgungsgesetz. Es gibt aber auch Kinder, die zwar in einem Hartz-IV-Haushalt leben, aber keine Sozialleistungen oder Wohngeld erhalten, mahnt die Linkenpolitikerin Katja Kipping. Eine Lücke im Gesetz verursacht dieses Problem. Dennoch sollte ein Antrag gestellt werden. Denn automatisch wird in solchen Fällen der Bonus nicht ausgezahlt. Für das Jobcenter sind die betroffenen Kinder “ohne Leistungsanspruch”.
12.09.2021 07:16:32 [Untergrund-Blättle]
Geflüchteten-Lager in der Schweiz als Dumping-Arbeitsmarkt
Ich lebe seit zwei Jahren in Geflüchteten-Camps in der Schweiz. Während dieser Zeit hielt ich mich gegen meinen Willen in insgesamt sechs Lagern auf (eines davon war das Deportationslager, in das ich nun verbannt wurde). Obwohl es zwischen den Kantonen einige Unterschiede in der Praxis gibt, funktioniert das System insgesamt nach der gleichen Grundlogik: Geflüchtete werden sowohl in den Primärlagern als auch in den integrierten Lagern als billige Arbeitskräfte eingesetzt.

Ich möchte hier meine Beobachtungen mit euch teilen: In allen Lagern verhalten sich die Lagerleitungen wie Subunternehmen. Der Bedarf an Arbeitskräften aus dem öffentlichen und privaten Sektor wird der Lagerleitung mitgeteilt.

12.09.2021 07:37:20 [Brave New Europe]
Another myth spread by platform companies is proven false
Platform workers can shift from independent contractor status to employee status and still retain flexibility, according to new, as yet unpublished research presented by gig economy scholar Juliet Schor in a key note address on Friday [10 September].

Schor, economist and sociology professor at Boston College in the US and author of ‘After the Gig’, was speaking at the ‘Reorganising Work’ virtual conference about gig workers and employment classification, a key issue in the European Commission’s ongoing work to develop a Directive on platform work.

12.09.2021 09:46:36 [Krass & Konkret]
Weltweit größtes Experiment zur Verkürzung der Arbeitszeit in Island mit verblüffendem Erfolg
Auf Druck der Gewerkschaften und zivilgesellschaftlicher Gruppen hatten der Stadtrat von Reykjavík und die isländische Regierung 2015 das weltweit größte Experiment zur Arbeitszeitverkürzung gestartet. Vier Jahre lang haben 2.500 Beschäftigte aus über 100 Unternehmen statt 40 im Schnitt nur 35 oder 36 Stunden in der Woche gearbeitet und das bei vollem Lohn.

Die nun vorliegende Studie zeigt, dass der Versuch einer Arbeitszeitverkürzung im Öffentlichen Dienst ein überwältigender Erfolg war und dass der Öffentliche Sektor ein Vorreiter bei kürzeren Arbeitswochen sein kann.

Der Versuch war so erfolgreich, dass nun generell die Arbeitszeitregelungen in Island geändert wurden.

12.09.2021 10:04:12 [Telepolis]
Arbeitslosigkeit: Widerstand gegen Forderung aus Union für Arbeitsdienst
Konservative Politiker haben es kurz vor der Wahl zum Bundestag schwer: Ihnen sind die Themen ausgegangen und sie wissen sich kaum zu helfen, wie sie noch punkten können. Vor diesem Hintergrund ist wohl die jüngste Forderung führender Unionspolitiker und der Freien Wähler nach einem obligatorischen Arbeitsdienst für Langzeitarbeitslose zu verstehen.

Sie drängen auf einen solchen Arbeitsdienst, angelehnt an die Politik der Sozialdemokraten in Dänemark. Die dänische Regierung hatte kürzlich angekündigt, Arbeitslose für gemeinnützige Arbeiten bis zu 37 Stunden in der Woche zu verpflichten.

12.09.2021 15:59:19 [Aktuelle Sozialpolitik]
Zur Forderung nach einem Arbeitsdienst für Langzeitarbeitslose
In der sozialpolitischen Diskussion ist das ein beliebtes Muster: Man schaut (scheinbar) über den nationalen Tellerrand, greift sich – zumeist einzelne – Aspekte dessen, was dort vor sich geht oder diskutiert wird, heraus und präsentiert die als Anregung für unser Land. Die inhaltliche Streubreite dieses Vorgehens ist beträchtlich. Das kann getragen sein von der ehrenwerten Suche nach tatsächlichen Verbesserungen, also echten Reformen, man denke hier an gute Beispiele für die Bereiche Pflege und Rente. Nicht selten aber soll mit dem partikularen Verweis darauf, dass es in anderen Ländern „auch so läuft“, eine als „Reform“ getarnte geplante Verschlechterung legitimatorisch ummantelt werden.
13.09.2021 06:56:06 [Gegen Hartz]
Armutsrisiko so hoch wie nie
Armut ist in Deutschland eine reale Gefahr. Schon vor der Corona-Krise ist das Armutsrisiko deutlich gestiegen, zeigt eine Studie des Deutschen Gewerkschaftsbunds. Der DGB fordert daher dringende Maßnahmen, um dieser Entwicklung Einhalt zu gebieten. „Im reichen Deutschland nimmt das Armutsrisiko vieler Menschen zu, obwohl Wirtschaft und Arbeitsmarkt zumindest bis vor Corona gebrummt haben“, stellte DGB-Vorstandsmitglied Anja Piel fest. „Mit Corona hat sich die Situation vielfach weiter zugespitzt, denn insbesondere Geringverdiener wurden und werden weiterhin durch die wirtschaftlichen Einschränkungen belastet. Ihre Einkommen sind durch Kurzarbeit oder Arbeitslosigkeit deutlich geschrumpft.“
13.09.2021 13:50:49 [Junge Welt]
Gute-Kita-Zulage: Schuss in den Ofen
Am Ende hat es Sandra Scheeres gut gemeint, auf die sozialdemokratische Art. Seit zehn Jahren ist sie Senatorin für Bildung, Jugend und Familie in Berlin. Dieses Ressort ist als Augiasstall bekannt, und Scheeres zwar als unnachgiebig, aber nicht so wie Herakles. Nach der Wahl am 26. September wird ein Senat ohne die gebürtige Düsseldorferin gebildet werden. Zum Abschied von der übergroßen Aufgabe ließ sie als letzten Beweis ihres guten Willens am vergangenen Mittwoch eine »Brennpunktzulage« für Kitas in ärmeren Vierteln in Kraft treten (jedes dritte Kind in der Stadt ist auf Sozialleistungen angewiesen, insgesamt rund 175.000).
13.09.2021 18:43:32 [Der Freitag]
Eine Rente ohne Armut
Sicherheit für alle im Alter, das wünschen sich vor dieser Wahl viele. Möglich ist das durchaus – mit einem Systemwechsel. Was soll nach dieser Wahl angegangen werden? In einer der vielen Umfragen nannten Befragte jüngst „die“ Rente als oberste Priorität, mit Abstand. Die Leute haben ein Gespür für die wirklich großen Baustellen des Landes. Aber die meisten Parteien machen keine konkreten Vorschläge, was denn nun anders werden soll. Schnell zur Hand ist dann eine weitere Anhebung des Renteneintrittsalters, weil „die“ Lebenserwartung ansteigt – da „wir“ ja länger leben, können „wir“ doch etwas länger erwerbsarbeiten; überhaupt gehe es „den“ Rentnern im Durchschnitt ganz gut.
13.09.2021 19:00:19 [Opposition 24]
Das kostet die Ganztagsbetreuung wirklich
Kurz vor den Wahlen haben sich "Bund" und "Länder" dazu durchgerungen, die umstrittene "Ganztagsbetreuung" an Grundschulen gesetzlich zu verankern. Wer bezahlt das und vor allem womit? Der finanzielle Aufwand ist schnell zusammengerechnet. 5,3 Milliarden Euro jährlich hatte die "Bertelsmann-Stiftung" 2019 verlautbart. Jetzt kommt der "Rechtsanspruch" erst ein Jahr später und der Bund schießt jährlich 1,3 statt 0,8 Milliarden Euro dazu. Macht also 6,6 Milliarden Euro pro Jahr. Und dem Geschrei der Kommunen und Lehrergewerkschaften nach zu urteilen ist damit noch lange nicht das Ende der Fahnenstange erreicht.
14.09.2021 06:34:57 [Gegen Hartz]
Psychischer Wertverlust durch Hartz IV
Alexander und Bettina Hammer veröffentlichten ihre Einsichten in die psychosozialen Probleme von Hartz-IV Betroffenen, die sich per Mail austauschten. Es handelt sich dabei nicht um „objektive Aussagen“, sondern um subjektive Befindlichkeiten, die es aber plausibel erscheinen lassen, dass ALG II, so die Autoren, sich zersetzend auf Psyche und Beziehungen auswirkt. Deutlich wurde zum Beispiel eine schrittweise Entwicklung der Betroffenen von Zuversicht, eine regelmäßige Erwerbstätigkeit zu finden dahin, andere Hartz-IV-Abhängige abzuwerten und sich selbst als „besser“ anzusehen.
14.09.2021 06:40:40 [TAZ]
Ausbeutung auf dem Fahrrad: Zehn Minuten bis zur Lieferung
Mike fährt für den Lieferdienst „Gorillas“, auf seinem eigenen Rad, für 10,50 Euro die Stunde. Aber er mag das Betriebsklima – und hofft auf Streik. Was kann jemand an einem Dienstagmittag so dringend brauchen, dass er es sich liefern lässt? Mitten in einem gutbürgerlichen Hamburger Stadtteil, wo niemand weiter als drei Ecken gehen muss, um den nächsten Supermarkt oder Kiosk zu erreichen?

Offenbar einiges. Gebucht per App, zugestellt von einem Kurierfahrer maximal zehn Minuten nach der Buchung, sind das an diesem Dienstagmittag zwei Dosen gehackte Tomaten und 15 Gramm Koriander.

14.09.2021 11:27:43 [Junge Welt]
Arbeitskampf: Streikfront steht
Berlin: Verdi setzt Ausstand an Kliniken fort. Landespolitiker schalten sich ein. Sie lassen nicht locker. Beschäftigte der kommunalen Kliniken Vivantes und Charité setzten am Montag ihren unbefristeten Streik fort. In den kommenden Tagen würden jeweils rund 1.000 Pflegekräfte ihre Arbeit niederlegen, teilte Meike Jäger, Verdi-Verhandlungsführerin, am Montag mit. »Dabei sind Betten und ab Dienstag auch ganze Stationen zur vorübergehenden Schließung angemeldet.« Ferner gingen Streikwillige bei den ­Vivantes-Tochtergesellschaften für Transport, Reinigung und Verpflegung wieder in den Ausstand.
14.09.2021 13:18:15 [Junge Welt]
Eine Altersarmutsrepublik
In Bayern wurde dieser Tage ein Mann vom Amtsgerichts Ebersberg zu einer Geldstrafe von 1.200 Euro verurteilt. Er hatte beim Aldi-Discounter Wurst im Wert von zehn Euro mitgehen lassen. Der Beklagte hat nach Eigendarstellung 30.000 Euro Schulden und nur 80 Euro im Monat für Einkäufe zur Verfügung. Seine Rente sei »zum Leben zu wenig, zum Sterben zu viel«, beschied er bei der Verhandlung. Wie ihm geht es vielen in Deutschland. Fast jeder fünfte über 65jährige ist von Altersarmut betroffen oder, wie es amtlich heißt, »bedroht«.
14.09.2021 14:37:39 [Heise]
LinkedIn diskriminiert Job-Bewerber aus anderen EU-Staaten
LinkedIn hat Probleme im Umgang mit dem in der EU geltenden Grundrecht auf Freizügigkeit, wonach Bürger der Gemeinschaft in jedem der Mitgliedsstaaten arbeiten und leben dürfen. Der von dem sozialen Netzwerk zur Pflege und zum Anbahnen von Geschäftskontakten angebotene Service "Recruiter" stuft laut einem Bericht der Organisation AlgorithmWatch Bewerber, die sich für einen Job in einem anderen EU-Land bewerben, zum Teil automatisch als "nicht geeignet" ein. Experten sehen darin einen klaren Verstoß gegen europäisches Recht. Recruiter soll es Arbeitgebern einfacher machen, ideale Kandidaten für offene Stellen zu finden.
14.09.2021 16:41:16 [Junge Welt]
Arbeitskampf: Nicht verhandelbar
Es wird ernst, für rund 37.400 Beschäftigte und Auszubildende der holz- und kunststoffverarbeitenden Industrie in Niedersachsen und Sachsen-Anhalt jedenfalls. Am vergangenen Freitag war der Auftakt der Tarifverhandlungen. Ein neuer Flächentarifvertrag samt »Tarifvertrag Demographie« soll her. Beide sind zum 31. August ausgelaufen. Viel passiert ist in der ersten Runde nicht. Etwas indes war nicht so wie sonst: Die Gegenseite, die Verbände der deutschen Möbelindustrie VDM/VHK, ging in Vorleistung, legte eine Art Angebot vor. Dies sei »jedoch völlig unzureichend und nicht verhandlungsfähig«, wird der Verhandlungsführer der IG Metall (IGM), Markus Wente, in einer am Freitag nachmittag verbreiteten Mitteilung zitiert.
15.09.2021 07:04:38 [Migazin]
1,2 Millionen Minijobbern in Deutschland droht die Altersarmut
Fast 1,2 Millionen Minijobbern in Deutschland droht wegen fehlender Rentenansprüche die Altersarmut. Denn gut die Hälfte der rund 2,3 Millionen geringfügig Beschäftigten zwischen 25 und 65 Jahren zahlt nicht in die Rentenkasse ein, wie aus einer Antwort der Bundesregierung auf eine Kleine Anfrage der Linksfraktion hervorgeht. Den betroffenen Minijobbern bleibe damit im Rentenalter nur der Bezug der sozialen Grundsicherung (Hartz IV), hieß es. Wie aus Erhebungen hervorgeht, sind Ausländer sowie Deutsche mit Einwanderungsgeschichte überdurchschnittlich oft in Minijobs tätig und von Altersarmut betroffen.

15.09.2021 07:33:42 [Brave New Europe]
„The intersectional precarity of platform cycle delivery workers“
In this video, Ester Anaya Boig, from the Centre for Environmental Policy at Imperial College London, and Dr Cosmin Popan, from the Department of Sociology at Manchester Metropolitan University, summarise the findings of their paper (which can be accessed here) on the intersectional precarity of riders in the app-based food delivery sector. We publish it here with the permission of the authors.

This video will be shown at the ‘Cycling & Society 2021 symposium’, which starts on Thursday.

15.09.2021 13:40:47 [Deutschlandfunk Kultur]
Altersarmut bei Frauen: Von der Politik alleingelassen
Frauen erhalten hierzulande durchschnittlich 46 Prozent weniger Rente als Männer. In keinem anderen europäischen Industrieland ist die Rentenlücke zwischen Männern und Frauen so groß wie in Deutschland.

Inzwischen sind in Deutschland zwar drei von vier Frauen erwerbstätig. Doch noch immer arbeiten vor allem Mütter in Teilzeit. Außerdem verdienen Frauen durchschnittlich 18 Prozent weniger als Männer in gleicher Anstellung. Und das wirkt sich auf die Rente aus: Denn wer im Erwerbsleben weniger einzahlt, bekommt später auch weniger Rente.

 Umwelt, Ökologie, Verkehr, Tiere, Agrarpolitik/-wirtschaft, Klima, Energie, Atomkraft, Oel, Rohstoffe, Gentechnik, Konsum, Verbraucher (76)
01.09.2021 06:26:35 [Preußische Allgemeine Zeitung]
Wie grüne Doppelmoral den deutschen Wald zerstört
Während einerseits für den „Klimaschutz“ massiv aufgeforstet wird, zerfurchen gigantische Windkraftanlagen andernorts artenreiche Waldbiotope. Doch langsam formiert sich Widerstand. Im Rahmen eines Grußwortes zum 30-jährigen Bestehen der Deutschen Bundesstiftung Umwelt (DBU) wies Bundeskanzlerin Angela Merkel am 1. März zum wiederholten Mal auf die Bedeutung des Naturschutzes hin. Der Rückgang der Artenvielfalt müsse aufgehalten werden. Bemerkungen wie diese beinhalten stillschweigend eine kalte Doppelbödigkeit, da die deutschen Wälder offiziell für die Errichtung von Windparks freigegeben wurden und damit unsere wertvollsten Naturschätze, Kohlenstoffspeicher und Klimaanlagen.
01.09.2021 09:04:48 [Amerika 21]
Alba-Staaten entwickeln gemeinsame Vorschläge für Klimagipfel in Glasgow
In Venezuela hat das zweite internationale Forum "Wiederbegegnung mit Mutter Erde" (Reencuentro con la Madre Tierra) zur Vorbereitung des Weltklimagipfels in Glasgow (COP-26) stattgefunden. Vertreter von Regierungen und Basisruppen aus 18 Ländern haben bei der zweitägigen Veranstaltung in Caracas Vorschläge ausgearbeitet, welche die Alba-Mitgliedsländer beim COP-26 vom 31. Oktober bis zum 17. November in der schottischen Hauptstadt einbringen sollen.

In der Abschlusserklärung schlagen die Teilnehmer den Staats- und Regierungschefs 18 Punkte vor, die sie am UN-Gipfel thematisieren sollen.

01.09.2021 09:20:44 [Brave New Europe]
Industrialised nations cracking down on environmental protests
Nicholas Sheldrick was never a protester, nor would he have described himself as an environmentalist, until one day in 2011 he felt the tremors of an earthquake induced by fracking, the controversial process of the hydraulic fracturing of shale rock to recover gas. He then started looking into its impacts, which include water pollution from toxic chemicals, as well as peer-reviewed studies connecting the fracking boom in the United States to massive methane emissions. Still, it took a few more years before he decided to join the anti-fracking movement.
01.09.2021 12:17:35 [Eike]
August 2021 in Deutschland – als der Sommer verloren ging
Nach einem sehr wechselhaften, aber noch mäßig warmen Juli schaltete der August zwei weitere Gänge zurück: Sonne und Wärme nur in homöopathischen Dosen, häufige Schauer, Gewitter und Landregenfälle sowie oft schon septembertypische Temperaturen; mit etwa 16,4°C im DWD-Deutschlandmittel gehörte er zu den kühlsten der letzten drei Jahrzehnte; auf der Zugspitze zog im letzten Monatsdrittel schon der Winter ein. Auch 2021 galt: Der Witterungstrend zum Monatswechsel Juli/August setzt sich oft fort.
01.09.2021 12:19:20 [Spektrum]
In den Ozeanen droht »andere Welt«
Noch schlucken die Ozeane große Mengen an Kohlendioxid und wirken als Puffer, welche die Erderwärmung dämpfen. Die Frage ist allerdings, wie lange die Meere dies noch leisten können. Denn sie selbst drohen sich drastisch zu verändern, wie eine Studie in »Scientific Reports« von Katie Lotterhos am Northeastern University Marine Science Center und ihrem Team nahelegt: Bis Ende des Jahrhunderts werden demnach je nach Emissionsszenario zwischen einem Drittel und 95 Prozent aller oberflächennahen Meeresökosysteme wie Seegraswiesen, Korallenriffe oder Wattgebiete Bedingungen erleben, wie sie im Lauf der Erdgeschichte nur selten oder sogar noch nie geherrscht haben.
01.09.2021 12:20:42 [Klimareporter]
Der Regen-Turbo
Die verheerende Flutkatastrophe in Rheinland-Pfalz und Nordrhein-Westfalen ist rund fünf Wochen her. Die Wassermassen rissen viele Häuser weg, zerstörten Straßen, Brücken und Mobilfunkmasten. Rund 200 Menschen starben.

Neben Deutschland waren Mitte Juli auch Teile Belgiens, Luxemburgs, der Niederlande, Österreichs und der Schweiz von schweren Sturzfluten oder Überschwemmungen an Flüssen betroffen. Die Kosten werden hierzulande auf rund 15 Milliarden Euro geschätzt, womit die Katastrophe das bisher teuerste Flutereignis in Deutschland wäre.

01.09.2021 12:22:01 [Telepolis]
Die Kandidierenden und die Klimafrage
Die Energie- und Klimawochenschau: Hurrikan Ida, Lücken der künftigen und der aktuellen Klimapolitik und Starkregen statt Dauerregen. In den USA ist am Sonntag Mittag (lokaler Zeit) der Hurrikan Ida der Kategorie 4 auf Land getroffen. Er traf die Küste bei New Orleans so wie vor 16 Jahren der verheerende Hurrikan Katrina die Küste traf. Äußerst ungewöhnlich war die Dauer von sechs Stunden, mit der Ida die Stärke eines Kategorie-4-Hurrikans behielt. Vergleichbare Stürme in der Vergangenheit schwächten sich innerhalb von drei Stunden zur Kategorie 3 ab.

Dafür hatte Ida um so rascher an Stärke gewonnen, in weniger als 24 Stunden von Kategorie 1 zu Kategorie 4.

01.09.2021 12:23:25 [TAZ]
Waldsterben in Deutschland: Wenn die Buchen schwinden
In Südhessen macht der Klimawandel den Bäumen zu schaffen. Ein Forstwirt und eine Hobbyfotografin wollen sie retten – auch vor der Forstwirtschaft. Es sind über 30 Grad in der Sonne, mal wieder. Um der Hitze zu entgehen, sitzen Yvonne Albe und Volker Ziesling im Schatten der Bäume, auf einer frisch gefällten Lärche. Die Hobbyfotografin und der Forstwirt bereiten eine ihrer Erkundungen auf dem Felsberg am westlichen Rand des Odenwaldes vor. Sie sind ein eingespieltes Team, wenn es darum geht, den nahenden Kollaps des Waldes zu erspüren – und zu erklären, wie sie ihn aufhalten wollen.
01.09.2021 12:50:55 [Brave New Europe]
How can the climate movement escalate to shift power?
We remember the moment that it dawned upon us that doing or supporting research on the science of climate change was not enough, but that the solution to the climate crisis would only come through movement building to enable collective political action. For Payal it was being stuck in a torrential downpour in Mumbai — while it didn’t make the international news like the flooding in Germany did this summer, there was close to 1000 mm of rain within 24 hours between 26–27 July 2005, resulting in over 1000 lives lost and bringing the city to a completely shutdown.
01.09.2021 15:50:27 [Der Freitag]
„Grünes Wachstum“ wird uns nicht retten
Alle Versuche, den wachsenden Wohlstand zu ökologisieren, sind nicht nur gescheitert, sondern mitunter kontraproduktiv. Es hilft nur Einschränkung. Ein „grünes“ Wachstum soll erwirken, dass die industrielle und digitale Wirtschaft weiter expandieren kann, ohne Schäden zu verursachen. Ressourcen sollen effizienter genutzt, Stoffkreisläufe geschlossen und erneuerbare Energien eingesetzt werden. Dieser auch als „Green (New) Deal“ bezeichnete Wohlstandsschutz erweist sich als verantwortungslos: Das Schicksal der Menschheit wird von einem Fortschritt abhängig, der nirgends eingetreten ist und dessen Entstehen unbeweisbar ist.
06.09.2021 06:38:00 [Deutschlandfunk Kultur]
Klimadebatte nach dem Discounter-Prinzip
Der vergangene Monat war nach Messungen der US-Klimabehörde NOAA (National Oceanic and Atmospheric Administration) weltweit der wärmste Juli seit Beginn der Aufzeichnungen im Jahr 1880.

Die Durchschnittstemperatur lag den Angaben zufolge – über alle Land- und Ozeanflächen hinweg – um 0,93 Grad Celsius über dem Durchschnittswert des 20. Jahrhunderts von 15,8 Grad. Besonders warm war es in Asien – aber auch in Nord- und Südamerika und in Afrika habe der Monat zu den zehn wärmsten je gemessenen Julis gehört. In Europa sei es der zweitwärmste jemals verzeichnete Juli gewesen, so die NOAA.

06.09.2021 07:22:38 [RT DE]
Wie Marketing unserem Planeten einheizt
Werbung und Marketing verschlingen große Mengen an Ressourcen: Kraft, Geld, Zeit, Brain, Energie und sind einer der größten Treiber der menschenverursachten Klimakrise. Werbung steht meines Erachtens im Zentrum unserer Klimakrise. Denn ohne das permanente Werbe-Sperrfeuer würde unser ganzes Wachstumsmodell, das uns ständig in mehr und neue Produkte und Dienstleistungen treibt, in "Haben" statt "Sein", in Gier statt Zufriedenheit, nicht funktionieren.

Deshalb ist jeder Euro Werbeersparnis ein realer Gewinn nicht nur für unsere Umwelt und unser Klima, sondern auch für uns Menschen, und macht unsere Welt lebenswerter.

06.09.2021 07:42:26 [Brave New Europe]
Nuclear energy is not a zero-risk technology
The Joint Research Centre (JRC) report, produced on behalf of the European Commission to assess whether nuclear energy can cause “significant harm” to human health and the environment, fails to consider in sufficient depth key risks such as the threat of catastrophic accidents and the proliferation of nuclear weapons. The JRC’s conclusion that nuclear energy does not cause significant harm and may therefore be promoted by the EU as a “sustainable” technology in tackling climate change does not stand up to scrutiny, as the Oeko-Institut’s analysis shows. Judging solely by the risk of severe accidents, it is self-evident that “significant harm” cannot be ruled out and that nuclear energy therefore cannot be classed as “sustainable”.
06.09.2021 13:16:49 [Eike]
Die wundersame Erholung des Great Barrier Reef
Das Great Barrier Reef, das sich über 344’000 Quadratkilometer Fläche erstreckt, hat in letzter Zeit wieder einmal für Schlagzeilen gesorgt. Im Juli war das Welterbe-Komitee der UnoOrganisation Unesco drauf und dran, das als Weltnaturerbe klassifizierte Korallenriff bei Australien als «gefährdet» einzustufen. Wegen der höheren Wassertemperaturen und der steigenden Versauerung der Ozeane soll das Riff in seiner Existenz bedroht sein.

Die Rückstufung wäre eine Peinlichkeit für Australien gewesen. Zudem wäre die touristische Ausstrahlung des Great Barrier Reef in Frage gestellt worden. Das Riff besitzt einen Vermögenswert von geschätzten 20 Milliarden Franken.

06.09.2021 13:17:47 [Telepolis]
New York unter Wasser
Die Überreste von Hurrikan "Ida" sind in der Nacht auf Donnerstag (Ortszeit) in New York angekommen und hatten noch immer extremen Niederschlag im Gepäck. Nachdem das regenschwere Tiefdruckgebiet bereits durch einige Bundesstaaten in Osten der USA schwere Überschwemmungen und Zerstörungen verursacht hatte, war nun auch die Metropole am Hudson betroffen.

Auf Twitter veröffentlichte Videos zeigen Sturzbäche, die sich über Treppen in U-Bahnstationen ergießen, überschwemmte Straßen und Wohnungen sowie Fontänen, die Gullydeckel wegdrücken und aus der Kanalisation aufsteigen.

06.09.2021 13:19:35 [Ausgestrahlt]
Fukushima-Framing
Das „Schönreden“ der Folgen der Reaktorkatastrophe von Fukushima erreicht mehr als zehn Jahre nach dem Ereignis einen neuen Höhepunkt. Ein Team der internationalen Atomenergielobby IAEO hat eine Einschätzung zur Bewältigung abgegeben, die teilweise ehrlich, aber extrem verharmlosend ist.

Es handelt sich um den fünften, umfangreicheren Bericht der IAEO zur Lage in Fukushima. Das Team habe seit der letzten Überprüfung im Jahr 2018 „Fortschritte in einer Reihe von Bereichen“ feststellen können. Ob jedoch – so wie von AKW-Betreiber TEPCO immer wieder propagiert – die „Stilllegung“ der zerstörten Meiler innerhalb der kommenden 30 Jahre abgeschlossen sein werde, sei zweifelhaft.

06.09.2021 13:20:40 [Telepolis]
16 Jahre Angela Merkel: Am Ende bleibt nur schlechtes Klima
Angela Merkel wird bald nach fast 16 Jahren an der Macht – nur drei Monate weniger als Rekordhalter Helmut Kohl – ihre politische Karriere als deutsche Bundeskanzlerin beenden.

Sie regierte zuerst in einer Koalition mit der SPD, dann ab 2009 für vier Jahre mit der FDP und seit 2013 wieder mit der SPD. Die Presse – und in einigen Jahren dann wohl auch die Historiker – sehen die Zeit gekommen, ihre politische Tätigkeit zu beurteilen.

Erste repräsentative Umfragen, etwa von Infratest dimap für den ARD-Deutschlandtrend, ergeben, dass die Deutschen auf die letzten 16 Jahre mit Merkel mehrheitlich positiv zurückblicken.

06.09.2021 13:22:02 [Scinexx]
Ozeane: Ganze Nischen verschwinden
Der Ozean ist einer der wichtigsten Klimapuffer unseres Planeten, aber auch an ihm geht der Klimawandel nicht spurlos vorüber. Schon jetzt erlebt er Hitzewellen und Rekordtemperaturen, der Sauerstoffgehalt sinkt, die Wasserschichtung wird undurchlässiger und die Versauerung lässt den gelösten Kalk in Form von Aragonit mancherorts knapp werden.

Bisher können viele Meeresbewohner diesen Veränderungen noch ausweichen, indem sie beispielsweise in noch kühlere oder weniger von Versauerung betroffene Meeresgebiete auswandern.

06.09.2021 13:43:37 [Brave New Europe]
200+ health journals: Call for emergency action
The UN General Assembly in September, 2021, will bring countries together at a critical time for marshalling collective action to tackle the global environmental crisis. They will meet again at the biodiversity summit in Kunming, China, and the UN Climate Change Conference of the Parties (COP26) in Glasgow, UK. Ahead of these pivotal meetings, we—the editors of health journals worldwide—call for urgent action to keep average global temperature increases below 1·5°C, halt the destruction of nature, and protect health.
Health is already being harmed by global temperature increases and the destruction of the natural world, a state of affairs health professionals have been bringing attention to for decades.

07.09.2021 07:22:40 [Brave New Europe]
Klaus Dodds – Conflict, Borders, and Division
Interview: Jef Cauwenberghs: The first bad news, you write that the flooding we saw in Belgium in July 2021 was by no means the last major flood.

Klaus Dodds: Unfortunately not. Extreme heat and uncontrollable flooding will become part of the “new normal”. Until now, we Westerners have generally thought that we would be able to withstand this with our modern and sophisticated infrastructure. But what has happened in Belgium shows that Europe will not be spared.

For some years now, geologists have been talking about the Anthropocene, an era in which we humans begin to notice the impact of our presence on earth.

07.09.2021 13:22:44 [Neues Deutschland]
Im Meer wird der Sauerstoff knapp
Mit dem Klimawandel werden die Weltmeere nicht nur wärmer. Er macht auch deren oberste Wasserschicht immer dicker, sodass Sauerstoff von der Oberfläche immer schwerer in tiefere Bereiche der Ozeane kommt. Das sind die Ergebnisse einer Untersuchung eines internationalen Teams von Wissenschaftlern, die kürzlich in der Fachzeitschrift »Nature« veröffentlicht wurden. Besonders in küstennahen Meeren wachsen sauerstofffreie Todeszonen.

Das Wasser der Ozeane ist nicht homogen. Es ist vertikal geschichtet. Zuoberst ist eine weniger dichte Schicht wärmeres und salzärmeres Wasser, darunter sind salzigere, und kältere Schichten.

07.09.2021 13:24:06 [Klimareporter]
Parteien sind nicht auf 1,5‑Grad‑Kurs
Trotz voranschreitender Klimakrise haben die Parteien in Deutschland noch immer keine ausreichenden Überlegungen angestellt, wie die jetzt notwendige Klimapolitik aussehen könnte und welche Weichen dafür gestellt werden müssen. Das geht aus einer Analyse von Bundestagswahlprogrammen hervor, die der Leipziger Thinktank Konzeptwerk Neue Ökonomie jetzt vorgelegt hat.

Demnach genügt keines der Programme dem 1,5‑Grad-Ziel des Pariser Klimavertrags. "Die klimapolitischen Ziele der Parteien sind erschreckend weit entfernt von dem, was wir jetzt sofort als Gesellschaft umsetzen müssten, um katastrophale Umweltveränderungen und die damit einhergehenden sozialen Verwerfungen zu vermeiden", sagte Ronja Morgenthaler vom Konzeptwerk Neue Ökonomie.

07.09.2021 13:25:26 [Telepolis]
Arbeitsplätze vernichtet, um Klimaschutz zu verhindern
Glaubt man den Reden der Regierenden, dann haben Arbeitsplätze für sie eine hohe, wenn nicht gar die höchste Priorität. Jedenfalls immer dann, wenn die anstehende grundlegende Umgestaltung der Industriegesellschaft gefordert wird, wenn ein schneller Ausstieg aus der Kohle oder eine drastische Reduktion der Pkws angemahnt wird.

Eigentlich kann man es wirklich längst wissen, dass das nichts als billige Rhetorik ist. Spätestens der Umgang mit den Corona-Hilfen könnte das gelehrt haben, die mit keinerlei Auflagen hinsichtlich von Entlassungen oder Dividendenausschüttungen verbunden wurden.

07.09.2021 13:27:53 [Heise]
Energiekosten klettern weiter in die Höhe
Fürs Tanken, für Heizung und Strom müssen die Verbraucher deutlich tiefer in die Tasche greifen als zuvor. Wie aus einer Analyse des Vergleichsportals Verivox hervorgeht, lagen die Energiekosten bei einem exemplarischen Drei-Personen-Haushalt zuletzt bei 4063 Euro pro Jahr und damit rund 19 Prozent höher als ein Jahr zuvor, also im August 2020. Damals waren es 3411 Euro. "Die Kosten für Heizung, Strom und Sprit liegen aktuell auf dem höchsten Stand seit 2012", sagte Verivox-Experte Thorsten Storck.
07.09.2021 13:49:45 [Brave New Europe]
North Africa: Green Energy Grabs
Where the energy security of the North trumps the human rights and sovereignty of people in the south, where priorities are dictated by the richest and most powerful (states and multinationals), it is of paramount importance to scrutinise the political economy of energy transitions.

Two examples of renewable energy schemes in North Africa show how energy colonialism is reproduced in the form of green colonialism or green grabbing.

The Ouarzazate Solar Plan was launched in 2016 just before the Marrakech climate talks (COP22).

07.09.2021 17:14:57 [Der Freitag]
Er zeigte sich sehr betroffen
Armin Laschet will Deutschland so regieren wie NRW. In Sachen Klima kommt das einer Drohung gleich. Ein Huhn ist in die Tomaten entwischt. David Dresen fängt es vorsichtig wieder ein. Der 30-Jährige hat die Zucht von seinem Opa übernommen, hat sich eingearbeitet in artgerechte Haltung und alte Hühnerrassen: Bielefelder Kennhuhn, Le Bleu, New Hampshire. Dresen ist nach dem Studium wieder auf den Hof seiner Familie im rheinländischen Kuckum gezogen. Als Aktivist in eigener Sache und fürs Klima. Denn Kuckum im Kreis Heinsberg ist eines der letzten fünf Dörfer, die Bagger zerstören sollen, damit der Braunkohletagebau Garzweiler sich weiter in die Landschaft fressen kann.
08.09.2021 13:27:00 [Telepolis]
Kohleausstieg hinausschieben?
Der sogenannte Bürgerrat Klima hat am gestrigen Dienstag sein Abschluss-Gutachten vorgelegt. Der Rat besteht aus 160 zufällig ausgewählten Bürgern, die in den vergangenen Monaten mit Fachleuten aus Wissenschaft, Wirtschaft und Organisationen der Zivilgesellschaft diskutiert haben, wie die Klimaziele der Pariser Übereinkunft von 2015 umgesetzt werden könnten. Schirmherr des Rates war der ehemalige Bundespräsident Horst Köhler.

Zu den Empfehlungen des Bürgerrates gehört unter anderem der schnelle Ausbau der erneuerbaren Energieträger, damit diese schon 2035 100 Prozent des Stroms liefern können.

08.09.2021 13:28:10 [TAZ]
Wahlkampf mit Wald
Der „klima-angepasste Mischwald“ dient als Leitbild für die Zukunft. In ihrer am Dienstag veröffentlichten Waldstrategie 2050 legte Agrarministerin Julia Klöckner (CDU) dar, dass die Wiederaufforstung von Nadelbäumen nur dort geplant sei, wo Laubbäume nicht wüchsen.

Das bereits begonnene Waldumbauprogramm im Umfang von 1,5 Milliarden Euro soll in der kommenden Regierungsperiode fortgeführt werden. Weitere konkrete Zahlen dazu nannte Klöckner allerdings nicht.

08.09.2021 13:30:03 [Telepolis]
Wie wir mit Homeoffice und Briefen das Klima killen
Nicht nur die Digitalisierung, auch die in der Corona-Pandemie massiv ausgeweitete Arbeit am Heimarbeitsplatz hat Auswirkungen auf die CO2-Emissionen und damit auf den Klimawandel. Zwei Studien haben sich nun diesem Thema mit Blick auf Kommunikation und Arbeitsort gewidmet. Vorweg: Die Ergebnisse sind nicht erstaunlich, dürften aber der Debatte über Arbeitsorganisation in vielen Betrieben Aufschwung geben.

Das Online-Marketing-Unternehmen Sendinblue warb unlängst, nicht ohne Eigeninteresse, für die E-Mail-Kommunikation als "das eindeutig umweltschonendste Kommunikationsmittel".

08.09.2021 13:31:48 [Informationsdienst Gentechnik]
Glyphosat: Einsatz weiter eingeschränkt
Ab morgen ist es soweit: Landwirte dürfen den Unkrautvernichter Glyphosat nur noch in Grenzen versprühen, Privathaushalte bundesweit gar nicht mehr. Das sieht die geänderte Pflanzenschutzanwendungs-Verordnung vor, die heute im Bundesgesetzblatt veröffentlicht wurde. Sie ist Teil eines Gesetzespakets zum Natur- und Insektenschutz, das Bundestag und Bundesrat nach langem Ringen in der großen Koalition Ende Juni verabschiedet hatten.

Komplett und bundesweit verboten ist das Totalherbizid demnach in Haus- und Kleingärten sowie auf Flächen, die für die Allgemeinheit zugänglich sind wie Spielplätze oder Parkanlagen.

08.09.2021 17:26:13 [Tichys Einblick]
Die künstlich erzeugte Angst vor der Fünf-Grad-Erwärmung
Der IPCC-Bericht unterscheidet fünf verschiedene CO2-Entwicklungsszenarien. Warum hat der IPCC eigentlich Szenarien behandelt, die völlig irreal sind, wie das 8.5 oder das 7.0 Szenario ? Wie wir schon in „Unerwünschte Wahrheiten“, im Kapitel 39 dargelegt haben, würde das 8.5 Szenario zu einer Verfünffachung des Kohleverbrauchs führen. In der Grafik des IPCC werden in diesem Szenario ab 2080 120 Milliarden Tonnen CO2 ausgestossen. Wie realistisch ist das?

Die Bundesanstalt für Geowissenschaften hat in ihrer letzten Energiestudie 2019 die weltweiten Reserven an Gas, Öl und Kohle aufgeführt, wonach beim Verbrennen aller Reserven 3402 Milliarden Tonnen ausgestoßen werden.

09.09.2021 07:09:07 [ISW - sozial ökologische Wirtschaftsforschung]
Der Globus brennt
Griechenland brennt, Sizilien brennt, die Türkei brennt, Algerien brennt – Feuer rund um das Mittelmeer. Neben den südlichen Ländern Europas brennt es auch in Nord- und Südamerika, Afrika, Asien und Australien. Die grünen Lungen der Welt – Amazonien und Sibirien – ersticken im Rauch. Knapp 50 Grad Celsius auf dem 50sten Breitengrad in Kanada oder 48,8 Grad in Sizilien – glühend heiße Luft macht das tägliche Leben zur Qual und zerstört die Ernten. Das Schmelzen von Grönlands Gletscher geht unaufhaltsam weiter. Auf der anderen Seite der Wetterextreme: sintflutartige Regenfälle und gewaltige Stürme.
09.09.2021 07:29:44 [Brave New Europe]
Climate change: ditch 90% of world’s coal, 60% of oil and gas
Global mean surface temperatures reached 1.2°C above the pre-industrial average in 2020, and the Intergovernmental Panel on Climate Change warned in its recent report that Earth could hit 1.5°C in as little as a decade. The 0.3°C separating these two temperatures make a world of difference. Scientists believe that stabilising our warming world’s temperature at 1.5°C could help avoid the most serious effects of climate change.

Fossil fuels such as coal, oil and natural gas are the source of just over 80% of the world’s energy. Burning them accounts for 89% of human-derived CO₂ emissions.

09.09.2021 15:07:26 [Klimareporter]
Autokonzerne werden Klimaziele verpassen
Zum Auftakt der Internationalen Automobil-Ausstellung (IAA) am Dienstag haben sich um den Messeort München Demonstranten von mehreren Autobahnbrücken abgeseilt. Auf der Autobahn A9 erkletterten Aktivisten eine Schilderbrücke und überklebten die Aufschrift. "Verkehrskollaps 2000 m" stand dann eine Zeitlang zu lesen.

Wegen der Aktionen mussten Fahrbahnen zeitweise gesperrt werden, die Verkehrsbehinderungen hielten bis zum Mittag an. Einige Protestierer sehen sich jetzt Ermittlungen unter anderem wegen gefährlichen Eingriffs in den Straßenverkehr und Nötigung gegenüber.

09.09.2021 15:08:48 [TAZ]
Bürgerbeteiligung bei der Endlagerfrage: Keine Zeit für zu viel Streit
Wie sollen in Zukunft Bürger, Experten und Betroffene bei der Suche nach einem radioaktiven Endlager in Deutschland mitreden? Darüber gibt es zwischen den staatlichen Stellen und der selbstorganisierten „Fachkonferenz Teilgebiete“ einen offenen Streit. Und den finden alle gut, wurde am Dienstag deutlich, als die „Fachkonferenz“ ihren Abschlussbericht übergab.

„Der Konflikt zeigt das Erstarken der Zivilgesellschaft, ein gutes Zeichen“, sagte Hans Hagedorn, der „Partizipationsbeauftragte“ des Verfahrens.

Es geht um eine heiße Frage: Wo in Deutschland sollen für die nächsten eine Million Jahre 10.500 Tonnen hochradioaktiver Müll gelagert werden?

09.09.2021 15:10:16 [Telepolis]
Auto-Herstellung: "Menschenrechtlich relevante Risikobranche"
Immer größer, immer schwerer, immer leistungsstärker - das ist der Trend bei deutschen Autos. Und die Deutschen lieben ihre "Sport Utility Vehicles" (SUV): Im Jahre 2017 wurden erstmals mehr SUV und Geländewagen neu zugelassen als Kleinwagen. 2020 machten beide Fahrzeugtypen schon ein Drittel aller neu zugelassenen Fahrzeuge in der Bundesrepublik aus. Hält der Volkswagen-Konzern sein Ziel ein, dann liegt 2025 der SUV-Anteil an allen verkauften Fahrzeugen bei mehr als 50 Prozent.

Diese Entwicklung ist ein Problem für den Klimaschutz: Größere Fahrzeuge fressen mehr Sprit und stoßen mehr Kohlendioxid aus.

09.09.2021 15:11:42 [Klimareporter]
Mehr Holz und Carsharing
Klimaschutz ist besonders schwierig, wenn es um die Herstellung von viel genutzten Materialien wie Stahl oder Zement geht. Die Sektoren Gebäude und Verkehr gehören zu den wichtigsten Verbrauchern dieser Ressourcen, und das Wachstum in diesen Bereichen ist weltweit ungebrochen. Doch es gibt durchaus die Chance, hier umzusteuern, wie eine neue Studie zeigt.

Eine effizientere Nutzung von Materialien für Wohngebäude und Autos könnte danach bis 2050 enorme Mengen Treibhausgase einsparen, nämlich bis zu zwei Drittel des bisherigen Ausstoßes.

09.09.2021 15:21:05 [Infosperber]
Klima: Wie soll ein Planet ohne Exekutive die Krise meistern?
Der Weltklimarat fordert zum dringenden Handeln auf. Über das Was sollen Politiker der Welt gemeinsam entscheiden. Nur wie? In unseren Breiten sind sich alle einig, dass etwas geschehen muss. Doch wie es geschehen soll in einer Welt ohne Exekutive, das fragt niemand. Der neue IPCC-Report rüttelt auf, sagt aber den Politikern ausdrücklich nicht, was sie tun sollen: «Die Bewertungen sind für die Politik relevant, aber nicht präskriptiv: Sie können Projektionen des zukünftigen Klimawandels auf der Grundlage verschiedener Szenarien und der Risiken, die der Klimawandel mit sich bringt, präsentieren und die Auswirkungen von Reaktionsmöglichkeiten erörtern, aber sie sagen den politischen Entscheidungsträgern nicht, welche Massnahmen zu ergreifen sind.»
10.09.2021 13:21:22 [Infosperber]
Das Politikum Great Barrier Reef
Vielgestaltige Fische und Meeresgewächse, unglaubliche Farben, filigrane Pflanzen, die sich sachte in der Strömung wiegen: Was man hierzulande nur im Zoo bewundern kann, gibt es am anderen Ende der Welt sehr viel grösser: Das 2300 Kilometer lange und etwa 350‘000 Quadratkilometer grosse Great Barrier Reef ist nicht ein Riff, es sind tausende.

Die Rifflandschaft vor der australischen Küste ist eines der grössten Biotope weltweit, vergleichbar mit dem tropischen Regenwald. Seit den 1980er-Jahren ist sie als UNESCO-Welterbe anerkannt.

Menschlicher Einfluss hat dem sensiblen Unterwassersystem seither stark zugesetzt.

10.09.2021 15:02:07 [Klimareporter]
"Wird gebaut, wird besetzt"
"Der Verkehr ist schon nervig beim Schlafen, aber viel schlimmer ist die Kälte", erzählt Amina Guggenbichler, während sie zwischen den Zelten eine festgewalzte Erdtrasse hinter den Baustellengittern erklimmt. "Wir werden aber sicher nicht zuschauen, wie ein riesengroßes Projekt unsere Emissionen noch mehr in die Höhe treibt", fügt sie kampfeslustig hinzu.

Die junge Frau ist eine von Dutzenden Klimaaktivisten, die seit einer Woche gleich mehrere Baustellen der "Stadtstraße Hirschstetten" am Rande von Wien besetzt halten.

10.09.2021 15:03:16 [Heise]
Klimawandel: 90 Prozent der Kohle muss im Boden bleiben
89 Prozent der noch förderbaren Kohle im Erdboden muss dort bleiben, wenn wir zumindest eine fünfzigprozentige Chance behalten wollen, die globale Erderwärmung auf weniger als 1,5 Grad Celsius zu begrenzen. Das haben Forscher vom University College London auf Basis von Zahlen aus dem Jahr 2018 errechnet. Vom wirtschaftlich förderbaren Erdöl dürften wir demnach 58 Prozent nicht mehr anrühren, vom Erdgas 59 Prozent. Die globale Erdöl- und Erdgasförderung muss ihnen zufolge ab sofort und bis 2050 in jedem Jahr um 3 Prozent sinken, um uns zumindest eine realistische Chance zu bewahren, das immer unerreichbarer scheinende Ziel des Pariser Klimaabkommens doch noch zu schaffen.
10.09.2021 15:04:38 [Neues Deutschland]
Eine klimapolitische Initialzündung
Die Flutkatastrophe im Juni in Westdeutschland wird später vielleicht als Zäsur erscheinen. Denn sie war nicht nur so verheerend, weil ein Wetterextrem eintrat, das erst durch den Klimawandel so extrem wurde. Gravierender ist, dass die regionale Flut eine hoch entwickelte Vorzeigeregion Deutschlands traf, die über das ganze technische Schutzarsenal verfügte: Talsperren, Dämme, Hochwassermanagement und was moderne westliche Infrastruktur sonst noch aufbietet. Zur jetzigen Gewissheit, dass es auch hierzulande keine Sicherheit mehr vor den Folgen des Klimawandels gibt, gesellt sich eine weitere: Für einen überschaubaren Zeitraum wird sich die Risikolage eher weiter verschlechtern.
10.09.2021 15:08:07 [Eike]
Bloßstellung der Klima-Lügen und -Übertreibungen der Medien
Seit mehr als 20 Jahren haben düstere Warnungen über die globale Erwärmung und den „Klimawandel“ die Massenmedien im Sturm erobert. Alle paar Jahre haben die Klimaskeptiker behauptet, dass die Welt nur noch 12 Jahre Zeit hat, um das Blatt zu wenden. Vor 12 und 15 Jahren haben sie praktisch das Gleiche gesagt, aber dieses Jahr sagen sie es wieder!

Viele Nachrichten, viele Nachrichtensendungen und viele Filme, darunter auch viele Dokumentarfilme, haben vor der globalen Erwärmung und dem Klimawandel gewarnt, wie z. B. der 2006 mit einem Oscar ausgezeichnete Dokumentarfilm "An Inconvenient Truth" von Al Gore.

10.09.2021 17:23:56 [SoZ - Sozialistische Zeitung]
Die Erde brennt
Von Oregon in den Vereinigten Staaten über Antalya und Bodrum in der Türkei bis zu einigen der kältesten Gebiete Sibiriens haben im letzten Monat Waldbrände bei Temperaturen von über 40°C tausende Hektar verwüstet. Gleichzeitig gab es katastrophale Überschwemmungen in Deutschland und China.

Wissenschaftler weisen darauf hin, dass extrem hohe Temperaturen und katastrophale Wetterereignisse die neue Normalität sein werden. War­um?
Beginnen wir mit dem Hochdruckdeckel über Nordamerikas Westküste von Oregon bis nach Vancouver, der für die Landwirtschaft und die ländlichen Gemeinden katastrophale Folgen hat.

10.09.2021 19:03:42 [Der Freitag]
Klilmakrise: Wenn Kapitalismus auf Politikversagen trifft
Waldbrände hat es in Griechenland schon immer gegeben. Dass sie zuletzt so katastrophale Ausmaße angenommen haben, hat auch mit der Austeritätspolitik der EU zu tun. Nach dem Zweiten Weltkrieg erlebten Griechenlands ländliche Regionen zwei lähmende Bevölkerungsbewegungen – erst eine Abwanderung seiner Dorfbewohner, dann eine eigenartige Invasion an ihren Randgebieten. Diese beiden Wellen, unterstützt durch einen schwachen Staat und verstärkt durch die Klimakrise, haben das an und für sich überschaubare Drama der natürlich vorkommenden Waldbrände in die erschütternde Katastrophe dieses Sommers verwandelt.
11.09.2021 07:26:36 [Brave New Europe]
The „Big Lie“ of Blue Hydrogen Starts With Ignoring Basic Economics
As the oil and gas industry achieves success in pushing the world towards widespread adoption of methane-based blue hydrogen, some unexpected voices are calling out the industry on its deception of selling blue hydrogen as an affordable and clean source of energy.

In August, Chris Jackson resigned as head of the UK Hydrogen and Fuel Cell Association, calling blue hydrogen an “expensive distraction.”

To support his argument against blue hydrogen, Jackson accused the oil and gas companies pushing blue hydrogen of making false claims about the fuel’s true costs, noting that the UK Treasury has “been told that blue hydrogen is cheap.”

11.09.2021 13:54:54 [Klimareporter]
CDU bewegt sich klimapolitisch auf SPD zu
Noch vor wenigen Tagen beschränkte sich Andreas Jung, Fraktionsvize der Union im Bundestag, in der Klimadebatte bei den Umweltverbänden auf Allgemeinplätze: Abschaffung der EEG-Umlage, schnellere Planungsverfahren, Deckelung der CO2-Emissionen und "Technologieoffenheit" gehörten zu seinen wichtigsten Punkten.

Zu dem Zeitpunkt muss Jung als Mitautor eines ambitionierten Erneuerbaren-Papiers schon ziemlich genau gewusst haben, was dann gestern in 15 Punkten vom CDU-Präsidium beschlossen wurde. Davon ließ der CDU-Politiker, lässt man die Klimadebatte Revue passieren, aber kein Sterbenswörtchen verlauten.

11.09.2021 13:56:07 [TAZ]
Sonderwege beim Atommüll
Bei der Suche nach einem deutschen Endlager für den Atommüll hat das Land Niedersachsen einen Sonderweg angekündigt. Umweltminister Olaf Lies (SPD) will neben der bundesweiten Standortsuche durch die Bundesgesellschaft für Endlagerung (BGE) ein eigenes geologisches Gutachten in Auftrag geben, um den Boden in Niedersachsen gesondert auf die Eignung als Standort untersuchen zu lassen. Das bestätigte ein Sprecher des Umweltministeriums in Hannover gegenüber der taz.

„Das Gutachten soll im Herbst ausgeschrieben werden, wir erwarten Ergebnisse im Frühjahr 2022“, heißt es aus dem Ministerium.

11.09.2021 13:57:09 [Heise]
Klimawandel zwingt Bauern zu Anpassungen – doch in welche Richtung?
Die Bauern in Rheinland-Pfalz erwarten vom Klimawandel eher Nach- als Vorteile. "Für die Landwirtschaft sind die Gefahren aus heutiger Sicht größer als die Chancen", sagt der Präsident des Bauern- und Winzerverbandes Rheinland-Pfalz Süd, Eberhard Hartelt. Die Agrarwirtschaft könne sich naturgegeben nicht so schnell anpassen, wie das vielleicht nötig wäre, beispielsweise im Hinblick auf Resistenzzüchtungen gegen Schädlinge und Pilzinfektionen. "Erschwerend kommt hinzu, dass sich in Deutschland und Europa eine gewisse Innovationsfeindlichkeit gegenüber modernen Züchtungsmethoden entwickelt – Methoden, die fälschlicherweise mit klassischer Gentechnologie gleichgesetzt werden."
11.09.2021 13:58:37 [TAZ]
Kriminelle Landwirte am Mittelmeer
Am spanischen Mittelmeer kippt die Lagune Mar Menor. Schuld sind nach Ansicht der Regierung Dünger und Süßwasser aus illegaler Landwirtschaft. Die spanische Umweltministerin Teresa Ribera nimmt kein Blatt vor den Mund. „Wir müssen damit beginnen, das Gesetz durchzusetzen und diejenigen zu sanktionieren, die illegale Praktiken begehen“, erklärte die Ministerin für den ökologischen Übergang – so ihr offizieller Titel – am Montag vor dem Parlament.

Die sozialistische Politikerin macht damit ganz direkt die intensive Landwirtschaft und vor allem die illegalen Anbauflächen für das Umkippen der größten Mittelmeerlagune Spaniens, dem Mar Menor in der südostspanischen Region Murcia, verantwortlich.

11.09.2021 17:11:54 [TAZ]
IAA gibt sich geläutert
Elektroautos, wohin man auch blickt. Zwei komplette Hallen voller Elektro- und Lastenräder und ein großes Außengelände, wo diese probegefahren werden können. Und Konzernchefs, die auf schnelleren Klimaschutz drängen: Die Internationale Automobilausstellung ist nach einjähriger Coronapause und dem Umzug von Frankfurt nach München kaum wiederzuerkennen.

Zwar gibt es in einer Halle wie in alten Zeiten Oldtimer und aufgemotzte Rennwagen zu bewundern. Doch der Schwerpunkt hat sich nicht nur in den Ankündigungen verschoben, sondern auch auf dem Messegelände selbst.

12.09.2021 13:42:55 [Telepolis]
Geht dem Ozean der Sauerstoff aus?
Tonnenweise Fische und Krustentiere wurden im August an die Strände des Mar Menor im Südosten Spaniens geschwemmt, darunter Seepferdchen und kleinere Fischarten. Mehrere Strände wurden abgeriegelt. Trotzdem drang der faulige Gestank bis zu den Touristen, denen die Lust auf ein Bad in der schmutzigen Brühe längst vergangen war.

Umweltschützer schätzen, dass bis zu fünfzehn Tonnen Fische verendet sind. Es war das zweite große Fischsterben in der größten Salzwasserlagune Europas. Das erste Fischsterben war 2019 durch einen Starkregen ausgelöst worden, der die nahe gelegenen Felder überflutet hatte.

12.09.2021 13:44:42 [Heise]
Studie: Klimaneutralität in Deutschland kostet 6 Billionen Euro
Der Weg zur Klimaneutralität macht einer Studie zufolge immense Investitionen erforderlich. Ausgehend von einer konsequenten und raschen Umsetzung der Energiewende seien in Deutschland bis 2045 Gesamtinvestitionen in Höhe von rund 6 Billionen Euro notwendig, wie aus einer Untersuchung der Unternehmensberatung McKinsey hervorgeht.

Zugleich wird auf die Chancen verwiesen: Eine erfolgreiche Dekarbonisierung könne "substanzielle Teile" der Beschäftigung und des Bruttoinlandsprodukts sichern. Wie der klimagerechte Umbau der Wirtschaft gelingen kann und die Anstrengungen im Kampf gegen den Klimawandel erhöht werden können, ist ein großes Thema auch im Bundestagswahlkampf.

12.09.2021 13:46:20 [Klimareporter]
Lieber billigen als echten Ökostrom
Die Antwort der Deutschen Bahn zu Punkt eins des Fragenkatalogs kann sich sehen lassen: Wie hoch ist der Anteil erneuerbarer Quellen am Strombedarf der Bahn im Jahr 2019? Genau 61,1 Prozent.

Viel mehr erfuhr die Deutsche Umwelthilfe (DUH) bei ihrer kürzlichen Ökostrom-Umfrage jedoch nicht von Deutschlands größtem Verkehrsunternehmen.

Wie viel von dem Bahn-Ökostrom stammt aus eigenen Anlagen? Keine Angabe.

Welchen Anteil hat bei der DB Ökostrom aus sogenannten PPA-Verträgen? Keine Angabe. (Bei PPA kaufen Unternehmen den Ökostrom direkt aus Anlagen, die nicht oder nicht mehr über das Erneuerbare-Energien-Gesetz gefördert werden).

12.09.2021 13:47:50 [Eike]
Deutschlands Beinahe-Blackout
Mehrere deutsche Medien, darunter die «Frankfurter Allgemeine Zeitung» (FAZ), berichteten über eine heikle Situation bei der deutschen Stromversorgung. Am Abend des 14. August fiel die Produktion von erneuerbarer Energie zusammen. Die Stromerzeugung konnte nicht mehr mit dem Stromverbrauch Schritt halten. Wie rapportiert wurde, betrug die Stromnachfrage in Deutschland am frühen Abend des 14. August rund 50 Gigawatt. Die Produktion von Solarstrom, die am Nachmittag noch bei über 30 Gigawatt gelegen war, brach aber auf gerade noch 3 Gigawatt ein.
12.09.2021 13:50:51 [TAZ]
„Ohne Schutzgebiete geht es nicht“
Das Ziel, ein Drittel der Erde unter Naturschutz zu stellen, ist richtig, sagt Heidi Wittmer vom Zentrum für Umweltforschung. Aber: Es reicht nicht. TAZ: Frau Wittmer, die Natur lässt sich nicht durch Schutzgebiete erhalten, sagt der UN-Sonderberichterstatter für Menschenrechte und Umwelt. Hat er Recht?

Heidi Wittmer: Das würde ich so pauschal nicht sagen. Die Natur ist in den meisten geschützten Gebieten in einem deutlich besseren Zustand als außerhalb. Das gilt sicherlich nicht an jeder einzelnen Stelle, aber im Durchschnitt schon. Der Naturschutz durch Schutzgebiete ist nicht gescheitert.

13.09.2021 12:12:19 [Heise]
Mehr als 220 Aktivisten 2020 im Kampf für die Natur gestorben
Der Kampf gegen Landnahme und Raubbau an der Natur wird immer gefährlicher: Im vergangenen Jahr sind weltweit 227 Umweltschützer getötet worden, wie die Nichtregierungsorganisation Global Witness am Montag bei der Vorstellung einer neuen Studie mitteilte. Das waren mehr als vier Morde pro Woche und mehr als jemals zuvor. Drei Viertel der tödlichen Angriffe wurden in Lateinamerika registriert. In Kolumbien wurden 65 Naturschützer und Umweltaktivisten getötet, in Mexiko 30, auf den Philippinen 29 und in Brasilien 20. Die Organisation geht allerdings davon aus, dass die tatsächliche Zahl der getöteten Umweltschützer noch deutlich höher liegt.
13.09.2021 12:20:59 [Brave New Europe]
Scientists/Researchers call for Fossil Fuel Non-Proliferation Treaty
The fossil fuel system and its impacts are global and require a global solution. We call on governments to urgently commence negotiations to develop, adopt and implement a Fossil Fuel Non-Proliferation Treaty laying out a binding global plan to: End new expansion of fossil fuel production in line with the best available science as outlined by the Intergovernmental Panel on Climate Change (IPCC) and the United Nations Environment Programme. Phase out existing production of fossil fuels in a manner that is fair and equitable, taking into account the respective dependency of countries on fossil fuels, and their capacity to transition.

13.09.2021 13:28:09 [Eike]
Kalifornien kämpft mit Dieselgeneratoren gegen den Blackout
Kalifornien ist auf Dieselgeneratoren angewiesen, um Stromengpässe zu überbrücken. Kalifornien gilt als Vorzeigestaat. Kein anderer US-Bundesstaat hat die Umstellung auf erneuerbare Energie so weit vorangetrieben und so viele Windräder und Solarpanels installiert. Bis 2030 soll sich die Stromversorgung zu 60 Prozent auf Ökoenergie abstützen, und bis 2045 will der eine Pflicht, auf den Dächern von Neubauten Solarmodule zu installieren.× Bundesstaat ganz wegkommen von fossilen Brennstoffen. Seit letztem Jahr gibt es in Kalifornien

Doch der viele Sonnen- und Windstrom hat seine Tücken. Er fliesst nur, wenn der Wind weht und die Sonne scheint.

13.09.2021 13:29:25 [Heise]
Block 2 des AKW Beznau geht nach Revision wieder ans Netz
Der knapp 50 Jahre alte Block 2 des Schweizer Atomkraftwerks Beznau nahe der Grenze zu Deutschland geht nach einer Revision wieder ans Netz. Die Schweizer Atomaufsicht ENSI hat nun die Genehmigung erteilt, nachdem in dem Reaktor die Brennelemente gewechselt wurden und "weitere gesetzlich erforderliche Arbeiten" durchgeführt wurden, wie sie nun mitteilte.

"Das AKW Beznau 2 wurde am 6. August plangemäß zur Jahreshauptrevision heruntergefahren", schreibt das Eidgenössische Nuklearsicherheitsinspektorat. Es seien Komponenten- und Systeme überprüft sowie Instandhaltungsarbeiten an Anlagenkomponenten durchgeführt worden.

13.09.2021 13:30:51 [Ausgestrahlt]
Das wird ein zweites Zarnowiec
Es ist riskant, unwirtschaftlich und hilft nicht, das Klima zu schützen. Polen will trotzdem Atomkraftwerke bauen. Diese Idee ist nicht zum ersten Mal gescheitert.

Um die vereinbarten Klimaschutzziele zu erreichen, setzt Deutschland bekanntlich auf den Ausbau der Erneuerbaren Energien und hat dem Fortbestand der Atomenergie als auch der Kohle eine klare Absage erteilt. Die polnische Klimastrategie sieht hingegen vor, das bis 2040 (also in den kommenden 20 Jahren!) mehrere Atomkraftwerke mit einer Gesamtleistung von 6.000 bis 9.000 Megawatt (MW) gebaut werden sollen. Der erster Meiler mit einer Leistung von bis zu 1.600 MW soll schon 2033 in Betrieb gehen.

13.09.2021 18:52:50 [Zeit Online]
Kein Wahlprogramm erfüllt die deutschen Klimaziele
Mit keinem der Wahlprogramme der größeren Parteien zur Bundestagswahl können einer Studie zufolge die deutschen Klimaziele erreicht werden. "Die Unterschiede zwischen den Parteien sind deutlich", heißt es in einer Untersuchung des Deutschen Instituts für Wirtschaftsforschung (DIW) im Auftrag der Stiftung Klimaneutralität. "Jedoch liefert kein Programm schlüssige Konzepte, um die im neuen Klimaschutzgesetz gesetzten Ziele für das Jahr 2030 vollständig zu erreichen."

Die Forscher analysierten dafür die Wahlprogramme aller im Bundestag vertretenen Parteien außer der AfD, die die Klimaziele bis 2030 wie auch das Ziel des Pariser Abkommens, die Erderwärmung auf 1,5 Grad zu beschränken, ablehnt.

14.09.2021 06:57:21 [Brave New Europe]
Food production: more than third of manmade greenhouse gas emissions
Producing enough food for a growing world population is an urgent global challenge. And it’s complicated by the fact that climate change is warming the Earth and making farming harder in many places.

Food production is a big contributor to climate change, so it’s critically important to be able to measure greenhouse gas emissions from the food sector accurately. In a new study, we show that the food system generates about 35% of total global man-made greenhouse gas emissions.

14.09.2021 09:15:34 [ScienceFiles]
Das zukunftsweisende Entsorgungskonzept der Windkraft
Die Probleme, die sich mit der Entsorgung der ineffizienten und hässlichen Windturbinen verbinden, holen uns schneller ein als uns lieb sein kann. Nach 20, maximal 25 Jahren ist eine Windturbine am Ende, Schrott, muss entsorgt werden, weil es bislang kein anderes Konzept gibt, auf Mülldeponien entsorgt werden.

Pu Liu und Claire Barlow haben schon 2017 berechnet, was da an Schrott auf die Menschheit zukommt: 43.000.000 Tonnen Abfall nur aus den Rotoren der Windturbinen gibt es bis 2050. Zum Vergleich: Ein Airbus A380 wiegt rund 580 Tonnen. Der Abfallberg, der nur mit Rotorblättern von Windturbinen bis 2050 aufgetürmt wird, entspricht somit 74.138 Airbus A380.

14.09.2021 12:53:51 [Spektrum]
Bäume stärker bedroht als Tiere
Bislang kennt die Wissenschaft mehr als 60 000 Baumarten; und dutzende werden jedes Jahr neu beschrieben. Vor allem in den tropischen Berg- und Tieflandregenwäldern verbergen sich noch unbekannte Baumspezies. Doch ihre Vielfalt ist global bedroht, wie der neue »State of the World’s Trees Report« der Vereinigung Botanic Gardens Conservation International zusammenfasst: Ein Drittel der Baumarten ist demnach im Fortbestand bedroht, wobei die Zahl auch noch größer ausfallen könnte. Von vielen Gewächsen kenne man die Bestandsgrößen nicht, weil sie in von Botanikern nur selten besuchten Regionen wachsen. Nur etwas mehr als 40 Prozent weisen eine als sicher geltende Population auf.
14.09.2021 12:55:04 [Klimareporter]
Wie glaubwürdig ist die Klimapolitik der Union?
Armin Laschet ist verliebt in das Wort "plötzlich". Nach der letzten Europawahl, bei der die Grünen ihren Stimmenanteil hierzulande fast verdreifachen konnten, meinte er: Aus irgendeinem Grund habe der Klimawandel "plötzlich" eine große Rolle gespielt.

Plötzlich? 30 Jahre lang hatten die Unionsparteien das Thema, das die Überlebensfrage der Menschheit ist, nahezu verschlafen.

Und nach der Hochwasserkatastrophe in seinem Bundesland Nordrhein-Westfalen sagte der Mann, der Bundeskanzler eines der wichtigsten Industrieländer werden will, man könne doch wegen eines solchen Tages nicht die Politik ändern.

14.09.2021 12:56:15 [TAZ]
Klimaklagen gegen Landesregierungen
Es ist ein wütender Willkommensgruß an die neue schwarz-rot-gelbe Regierung von Sachsen-Anhalt, die am Montagmorgen in Magdeburg ihren Koalitionsvertrag unterschrieben hat: Das Bundesland gehört zu denen, die Klimaaktivisten gerade vor dem Bundesverfassungsgericht verklagt haben, wie sie am Montag bekannt gaben. Sie argumentieren, dass die Landesregierungen ihre Grundrechte durch mangelnden Klimaschutz missachten würden.

Die Verfassungsbeschwerden richten sich neben Sachsen-Anhalt auch gegen Sachsen, Hessen, Mecklenburg-Vorpommern und das Saarland.

14.09.2021 12:57:22 [TAZ]
EU-Gesetz zur Klimaneutralität: Der Ehrgeiz hält sich in Grenzen
Die Europäische Union tut immer noch nicht genug für den Schutz der Wälder vor kommerzieller Abholzung – und Besserung ist nicht in Sicht. Dies geht aus Vorarbeiten für ein neues EU-Gesetz vor, die der taz vorliegen. Das Gesetz, das im Dezember vorgelegt werden soll, ist Teil des „European Green Deal“ zur Klimaneutralität. Es soll verhindern, dass importierte Agrarprodukte etwa aus dem Amazonasgebiet in Brasilien zu Waldzerstörung beitragen.

Das öffentliche Interesse an dem Thema ist riesig: An einer Onlinebefragung zu dem Gesetzesvorhaben wurden fast 1,2 Millionen Beiträge eingereicht, wie es in dem geleakten Dokument heißt.

15.09.2021 07:09:20 [LinksNet]
Pestizide
Der Einsatz von Pestiziden hat laut Welternährungsorganisation FAO in den letzten Jahrzehnten weltweit stetig zugenommen. Momentaner Spitzenreiter beim Pestizidverbrauch pro Hektar Ackerfläche ist Ostasien, dicht gefolgt von Nord- und Südamerika sowie Europa. Ein dramatischer Anstieg ist v.a. in Südamerika zu verzeichnen: seit 1990 (und da wurde bekanntlich nicht bei Null angefangen) um fast 400 Prozent. Aber auch in europäischen Ländern wird weiterhin unbeirrt auf Pestizide gesetzt (Deutschland plus 60 Prozent). Dabei ist schon lange bekannt, dass mit dem Einsatz von Pestiziden ernsthafte Gefahren für die menschliche Gesundheit, die Tier- und Pflanzenwelt und damit auch für ganze Ökosysteme einhergehen.
15.09.2021 12:04:14 [Junge Welt]
Energiewende: Flaute für Windkraft
Keine gute Nachricht für den Klimaschutz: Für Kohlestrom gab es im ersten Halbjahr 2021 unverhofft Auftrieb. Eine wichtige Rolle spielte dabei das windarme Frühjahr, das für die überraschende Renaissance des dreckigen Stroms sorgte. Das Statistische Bundesamt hatte am Montag mitgeteilt, dass mehr als die Hälfte (55 Prozent) des erzeugten Stroms aus konventionellen Quellen stammt. Der Anstieg im Vergleich zum Vorjahreszeitraum macht demnach 20,9 Prozent aus. Vor allem aus Kohle wurde deutlich mehr Energie gewonnen, aber auch Atommeiler konnten mehr Energie ins Netz einspeisen.
15.09.2021 13:35:10 [TAZ]
Müllentsorgung am See: Der Badesee als nasses Grab
Warum fahren Menschen zum See, um dort ihren Abfall abzuladen? Mehr noch: Warum benutzen sie nicht einfach den Mülleimer? Noch eine letzte Kurve, ein letzter Blick in den Wald, eine letzte Horde von supercoolen Pubertierenden auf dem Weg, dann endet meine Joggingstrecke im Paradies. Ich trudele runter zum See, wische mir den Schweiß ab, setze mich auf die Wurzel unter dem dicken Ahorn und ziehe die Schuhe aus. Da zieht es mir wieder mal die Schuhe aus: Im Wasser am kleinen Sandstrand dümpelt nicht nur eine (dazu noch leere!) Bierflasche, sondern überall liegen Kronkorken. Selbstverständlich mit der scharfen Seite nach oben.
15.09.2021 13:36:46 [Telepolis]
Klimakrise: Die Kosten der Untätigkeit
Die Energie- und Klimawochenschau: Eine unkritische und schlecht vorbereitete Kandidatenbefragung, ein Hungerstreik fürs Klima und eine Wissenschaft ablehnende Digitalisiererin in Laschets Zukunftsteam. Das war schon eine sehr eigenartige Moderation des Dreikampfes der Kanzler-Kandidatinnen und -Kandidaten, den ZDF und ARD am Sonntag zur besten Sendezeit ausstrahlten. Deutschland erschien als eine einsame Insel im weiten Universum, hermetisch abgeschlossen gegen alle Einflüsse aus den fernen Galaxien jenseits von Rhein, Oder und Alpen.
15.09.2021 13:38:11 [Eike]
Klimawandel in 15 Minuten erklärt
Für die Politik ist die wichtigste Frage, wie viel Erwärmung wir im 21. Jahrhundert erwarten können. Diese Abbildung aus dem jüngsten IPCC-Bericht zeigt Klimamodellsimulationen der globalen Oberflächentemperaturanomalien im 21 Jahrhundert. Das Diagramm zeigt eine große Bandbreite der Erwärmung, die von 1,5 bis zu mehr als 4 Grad Celsius über den vorindustriellen Temperaturen reicht. Es ist bereits um etwa 1 Grad Celsius wärmer geworden, so dass es für die Klimapolitik von großer Bedeutung ist, ob die künftige Erwärmung eher am unteren oder am oberen Ende liegt.
15.09.2021 13:39:43 [Klimareporter]
Klimakrise viel teurer als bisher angenommen
"Es liegt noch viel Arbeit vor uns", sagte Bundeskanzlerin Angela Merkel (CDU) jetzt bei ihrem Besuch in den von der Flutkatastrophe besonders betroffenen Orten in Nordrhein-Westfalen.

Der Wiederaufbau werde lange dauern, das werde mit jedem Tag klarer. Auch die nächste Bundesregierung werde daher solche Besuche ansetzen müssen, so Merkel.

Bei den Überschwemmungen im Juli waren mehr als 180 Menschen umgekommen, es entstand ein Sachschaden in zweistelliger Milliardenhöhe – mehr als bei früheren Flutereignissen in Deutschland.

15.09.2021 15:45:40 [Brave New Europe]
Lessons from this summer’s calamitous Greek forests inferno
After the second world war, Greece’s countryside experienced two debilitating human surges – an exodus of villagers, then a most peculiar human invasion of its fringes. These two surges, aided by a weak state and abetted by the climate crisis, have turned the low-level drama of naturally redemptive forest fires into this summer’s heart-wrenching catastrophe.

After heatwaves of unprecedented longevity, wildfires across the summer months have so far destroyed more than 100,000 hectares (250,000 acres) of ancient pine forests.

16.09.2021 07:21:35 [Brave New Europe]
Global Update: Climate target updates slow as science demands action
The new IPCC report on climate science has reinforced the absolute urgency of closing the 2030 emissions gap if there is to be any chance of limiting warming to 1.5°C. While people are suffering from ever more severe and frequent impacts of climate change around the globe, and the IPCC has yet again clearly demonstrated the feasibility and urgency of climate change mitigation, action to reduce greenhouse gas emissions continues to lag behind what is needed – in practically all countries and sectors. International climate finance to support action in developing countries is falling short.
 Gesundheit, Gesundheitswesen, Gesundheitspolitik, Medizin, Ernährung (44)
01.09.2021 06:32:02 [GiB - Gemeingut in Bürgerhand]
Krankenhausschließungen als Prozess
Hinter allen Krankenhausschließungen liegen drei Grund-Ursachen: Erstens die seit Beginn der 1990er Jahre eingeführte Möglichkeit, Gewinne zu erwirtschaften, die mit Einführung des neuen Abrechnungssystems von DRGs (Fallpauschalen) 2004-05 zum Gewinnzwang wurde: Krankenhäuser, die auf Dauer Verluste erwirtschaften, geraten in eine Abwärtsspirale. Zweitens die unablässige Ausbreitung privater Krankenhäuser seit den frühen 2000er Jahren; Privatklinikträger können sich oft auf gewinnversprechende Leistungen konzentrieren und neigen rascher zu Schließungen bei unzureichender Rendite, während öffentliche Träger zu – oft nicht gewinnbringender – Basisversorgung verpflichtet sind.
01.09.2021 11:02:03 [Ansage!]
Wie Immune zur Impfung gezwungen werden
Es ist ein Dauerbrenner-Thema, das vor allem Genesene seit langem umtreibt, deren Corona-Infektion länger als sechs Monate zurückliegt: Diese brauchen nämlich zusätzlich zum amtlichen „Genesenenzertifikat“, das während des ersten Halbjahrs seit der Erkrankung als Immunitätsnachweis genügt, zwingend die Impfung. Allerdings nicht in zwei Dosen, sondern bei ihnen genügt nur eine, in Verbindung mit der das besagte, eigentlich abgelaufene Genesenenzertifikat dann unbefristet als vollwertige „Impfbescheinigung“ wirkt. So will es die deutsche Gesundheitsbürokratie.
01.09.2021 17:54:16 [ScienceFiles]
COVID-19-Impfung versagt: Das zeigen nun auch die Daten der WHO
Mit Politikern ist es wie mit Lügnern, die versuchen, mit allerlei Lügengeschichten durchzukommen. Erst wenn man Ihnen alle Löchern, durch die sie vor der Wahrheit entweichen können, zugemacht hat, findet sich der ein oder andere dieser Herrschaften vielleicht dazu bereit, die Wahrheit einzugestehen. Was die angebliche Effektivität der heilbringenden COVID-19-Impfung angeht, so haben wir in den vergangenen Tagen und Wochen eine ganze Reihe von Löchern zugemacht. Heute nun, stopfen wir ein weiteres, denn die Tatsache, dass COVID-19-Impfungen versagen, sie kommt nun auch in der Datenbank der WHO an, die eigentlich dazu gedacht ist, die unerwünschten Nebenwirkungen von Impfungen zu erfassen.
06.09.2021 06:45:32 [TAZ]
Diagnose Gewinnsucht
Vor der letzten Bundestagswahl hatte ich versucht, mir einen Überblick über die gesundheitspolitischen Vorstellungen der zur Wahl stehenden Parteien zu verschaffen. Das war gar nicht so einfach, denn das Thema fand im Wahlkampf kaum Erwähnung, von einigen wenigen Schlagzeilen abgesehen wie: „Tod durch Hygienemängel!“ „Profitgier von Ärztinnen führt zu unnötigen Operationen“. Schwarzen Schafen musste das Handwerk gelegt, strengere Kontrollen mussten eingeführt werden. Dann kam Covid-19, und unser Gesundheitssystem wurde zum Medienstar. Es war präsent von der intellektuellen Wochenzeitung bis hin zur Stammtisch-Whatsapp-Gruppe. Hauptsächlich wurde es gefeiert, doch es gab auch kritische Stimmen.
06.09.2021 13:29:25 [ScienceFiles]
Impfung schützt nicht: Die Liste der Belege wird immer länger
Wie nennt man jemanden, der mit dem Kopf gegen einen Felsen läuft und fest der Überzeugung ist, der Fels wird im weichen?

Ersetzen wir Kopf mit Impfung und Fels mit RNA-Virus, und wir kommen bei der derzeitigen absurden Situation an, in der es tatsächlich Leute gibt, die denken, man könne SARS-CoV-2 aus der Welt spritzen.

Die Belege dafür, dass das nicht funktioniert, die haben wir schon vor einiger Zeit zusammengetragen: COVID-19-Impf-Märchen – Gesammelte Belege, dass fast alles nicht stimmt. Seither haben sich eine Vielzahl neuer Belege eingestellt, die wir in diesem Post zusammenstellen und um neueste Daten aus Israel anfüttern wollen, die das zeigen, was man nur dann von der Hand weisen kann, wenn man ein mehr als gestörtes Verhältnis zur Realität unterhält.

06.09.2021 15:05:25 [ScienceFiles]
Spahn lügt: Pandemie der Unehrlichen
Beginnen wir zunächst mit der Behauptung, dass wir es derzeit mit einer “Pandemie der Ungeimpften” zutun haben. Wer angesichts von 61% Geimpften in der Bevölkerung eine solche Behauptung aufstellt, wer ignoriert, dass Impfung weder vor Ansteckung noch vor deren Weitergabe schützt, geschweige denn vor Hospitalisierung oder Tod, der hat entweder nicht mehr alle Tassen im Schrank oder er führt etwas Anderes im Schilde. Aber nicht nur wegen der 61% Geimpfter ist das so. Alle Daten, die uns derzeit aus Israel, dem Land der “Pandemie der Geimpften”, um einmal das aufzunehmen, was Spahn in die Welt setzt, erreichen, zeigen, dass maximal drei Monate in die Massenimpfung unter GEIMPFTEN die SARS-CoV-2-Infektionen explodieren.
06.09.2021 15:08:41 [Telepolis]
Covid-19-Impfung: Keine Garantie gegen die Viruslast
Forscher aus Oxford haben die Virus-Last von Geimpften und Ungeimpften in Großbritannien verglichen und dazu einige Millionen Nasen- und Rachenabstriche bei Erwachsenen unter die Lupe genommen.

Im August erschien ihr Papier mit ersten Ergebnissen (Preprint, 24. August). Es geht auf die Auswirkungen der Delta-Variante des Coronavirus Sars-CoV-2 auf die virale Belastung und die Wirksamkeit von Impfungen näher ein, speziell was das Thema Neuinfektionen betrifft. Sarah Walker leitete die Studie. Sie ist Professorin für medizinische Statistik und Epidemiologie an der Universität Oxford.

06.09.2021 15:11:31 [Infosperber]
Corona: Der Alarm zu den Intensivstationen war voreilig
Tagelang überschlugen sich Schlagzeilen, die Spitäler würden insbesondere auf Intensivstationen wegen Corona bald an Belastungsgrenzen stossen. Bereits wurde verbreitet, es hätten Operationen verschoben werden müssen – ohne Angabe wie viele und welche. Die Forderung wurde laut, die Zertifikatspflicht auf Restaurants oder sogar Züge auszudehnen und in Schulen schweizweit Masken zu tragen.

Am 1. September nun meldete das BAG, dass die Intensivstationen schweizweit zu 78 Prozent ausgelastet seien – ohne Aufstockung der Betten.


07.09.2021 07:00:15 [ScienceFiles]
Widerstand gegen Impf-Diktatur wächst
Das Impfen von 12 bis 17jährigen ist in Deutschland schon seit ein paar Wochen Normalität, so sehr, dass Jens Spahn, der den Bundesgesundheitsminister darstellt, bereits mit den Impfzahlen angibt: “Spahn: Mehr als eine Million Kinder ab 12 Jahren geimpft“. Es ist also möglich, sich als möchtegern-Minister damit zu brüsten, dass man Kinder vor etwas schützt, von dem ihnen keine Gefahr droht, und sie mit etwas schützt, von dem ihnen Gefahr droht (genannt Nebenwirkungen).

Es ist wohl kaum möglich, diesen Irrsinn zu steigern.

Indes sind Personen wie Spahn, deren Handeln die Bewertung “Irrsinn” nahelegt, nicht auf Deutschland beschränkt.

07.09.2021 17:09:00 [Tichys Einblick]
Wie das RKI die Wirksamkeit der Impfstoffe statistisch schönt
90 Prozent der Covid-Patienten auf deutschen Intensivstationen seien ungeimpft, gab Gesundheitsminister Jens Spahn jüngst bekannt. Medien berichten Erkenntnisse wie diese schon seit Wochen. Merkwürdig sind solche Zahlen vor allem deshalb, weil sie nicht unbedingt solchen aus dem Ausland entsprechen. In England etwa gehen staatlichen Daten zufolge knapp 70 Prozent der an der Delta-Variante des Corona-Virus verstorbenen Personen auf sogenannte Impfdurchbrüche zurück, also auf Menschen, die trotz Impfung an Corona erkranken. Bei den Hospitalisierungen sind es (Stand: 3. September) immerhin gut 55 Prozent.
07.09.2021 18:44:12 [RT DE]
Über erschreckende Tendenzen in der medizinischen Gemeinschaft seit COVID-19
Dies ist die Botschaft eines Arztes an alle, die befürworten, dass Menschen, die nicht gegen COVID-19 geimpft sind oder sich nicht impfen lassen wollen, eine medizinische Behandlung verweigert wird. In den Vereinigten Staaten, in Großbritannien und Teilen Europas hat sich eine heimtückische Haltung gebildet, die von Politikern, Experten und – am beunruhigendsten – Ärzten befeuert wird: Dass Ungeimpften, die sich mit COVID-19 infizieren, eine medizinische Versorgung verweigert werden soll. Dies würde einen gefährlichen Präzedenzfall schaffen und grundlegende Grundsätze der medizinischen Praxis im Kern erschüttern.
08.09.2021 15:20:54 [TKP]
Auch Peru zeigt erfolgreiche Behandlung mit Ivermectin
Ivermectin ist ein heftig umstrittenes Medikament ursprünglich zur zur Behandlung von Malaria entwickelt, aber nun höchst erfolgreich zur Prophylaxe und Frühbehandlung von Covid eingesetzt. In großflächigen Anwendungen wie in Indien bei Hunderten Millionen Menschen hat es bereits hohe Wirksamkeit bewiesen.

Eine neue in PubMed erschienene Studie zeigt die Wirksamkeit in Metaanalysen existierender Studien, sowie an Hand der Erfahrungen bei einem ebenfalls großflächigem Einsatz in Peru. Die Studie trägt den Titel: „Ivermectin: ein vielseitiges, mit dem Nobelpreis ausgezeichnetes Medikament mit nachgewiesener Wirksamkeit gegen eine neue globale Geißel, COVID-19.“

08.09.2021 17:23:16 [Medinside ]
«Die Covid-Impfstoffe werden unverantwortlich verharmlost»
Der Chirurg und Sportmediziner Urs Guthauser gehört zu den Ärzten, die der dominierenden Covid-Impf-Politik widersprechen. Was sind seine Argumente? Herr Guthauser, die Delta-Variante sorgt für steigende Spitaleinweisungen, der Druck auf die Ungeimpften steigt – auch auf Kinder und Jugendliche. Sie sind Mitgründer des offenen Netzwerkes «Aletheia». Auf Ihrer Internetseite heisst es «Hände weg von unseren Kindern». Was löst die Impfkampagne des Bundes bei Ihnen aus? Unverständnis und einen grossen Schrecken. Es gibt überhaupt keinen Grund, Kinder und Jugendliche zu impfen.
08.09.2021 18:55:08 [RT DE]
Grippe-Impfung kann gegen Symptome von COVID-19 helfen
Trotz der Negativ-Kampagne in den Medien machten sich schon Mitte 2020 zahlreiche Forscherteams an die Arbeit, nach weiteren Möglichkeiten der Pandemie-Bekämpfung zu suchen. Seitdem tauchen immer häufiger Ergebnisse auf, die einen signifikanten Zusammenhang zwischen einer Grippe-Impfung und einem deutlich leichteren Verlauf im Falle einer COVID-19-Erkrankung belegen. Heute gibt es mindestens 30 Untersuchungen aus verschiedenen Ländern, die in die gleiche Richtung deuten. Eine neue weltweite Datenüberprüfung scheint diese These zu bestätigen. Die Arbeit erhielt ein gewisses mediales Echo, doch bis heute hat sie keine spezielle Reaktion seitens der Regierung oder gar der WHO hervorgerufen.
09.09.2021 09:21:38 [ScienceFiles]
COVID-19-Impfstoffe: Nebenwirkungen, von denen niemand wissen will
Seit 19 Wochen analysieren wir die Datenbank der WHO, die Datenbank, in der u.a. die Nebenwirkungen von COVID-19-Impfstoffen gesammelt werden.
Seit 19 Wochen analysieren wir eben diese Nebenwirkung von COVID-19-Impfstoffen. Mit der Zeit gewinnt man ein Gefühl für die Daten und die Art und Weise ihrer Erfassung und kann darauf eine Bewertung von Datenqualität und Verlässlichkeit der Datenerfassung gründen. Unsere Bewertung für die Datenbank der WHO ist in allen Belangen negativ. Die Daten werden für die WHO in Schweden erfasst. Die University of Uppsala ist dafür verantwortlich. Die Erfassung erfolgt in einer Weise, die jeder externen Auswertung so viele Steine wie nur möglich in den Weg legt.

09.09.2021 13:24:45 [Die Ostschweiz]
Der «Impfdurchbruch»: So wird er definiert
Die Impfung ist in aller Munde, und in diesem Zug kommt das Wort «Impfdurchbruch» vermehrt auf. Wie dieser definiert wird, lässt allerdings tief blicken. Niemand bestreitet es, wenigstens das nicht: Wer gegen Covid-19 geimpft ist, kann dennoch am Virus erkranken. Die Impfung, wie praktisch jede andere, bietet keinen 100-prozentigen Schutz.

Von einem Impfdurchbruch spricht man, wenn jemand, der vollständig geimpft ist,dennoch Coronasymptome zeigt. Aber auch das erst, wenn mindestens 14 Tage vergangen sind, weil der Schutzeffekt seine Zeit braucht, wie Experten sagen. Jemand, der einige Monate nach dem zweiten Piks plötzlich die typischen Symptome aufweist, wandert in die Statistik der Impfdurchbrüche.

09.09.2021 13:26:23 [TKP]
Ärztekammer Nordrhein warnt vor dritter Covid Spritze
Bekanntlich lässt die Wirksamkeit der derzeit für Impfungen verwendeten gentechnischen Präparate innerhalb von wenigen Monaten nach. Als Gegenmittel soll nun nach 5 bis 6 Monaten eine dritte Spritze mit dem gleichen Impfstoff folgen. Die ersten Erfahrungen damit in Israel sind allerdings nicht gerade ermutigend.

Im August, dem ersten Monat wo die dritte Spritze massenhaft verabreicht wurde, gab es wie berichtet bereits 62 Covid zugeschriebene Todesfälle bei dreifach Geimpften und 313 bei mit 2 Dosen Geimpften. Insgesamt betrafen 64,1% der Todesfälle bereits geimpfte Personen.

09.09.2021 13:29:28 [Telepolis]
Corona-Politik: Krankenkasse warnt vor
Die Pandemie-Politik hat laut einer Studie der Krankenkasse DAK gravierende Auswirkungen auf die Gesundheit von Kindern und Jugendlichen in Deutschland. Alleine im Jahr 2020 seien im Vergleich zum Vorjahr in den Krankenhäusern 60 Prozent mehr Mädchen und Jungen aufgrund einer Adipositas behandelt worden.

Zugleich sei die Zahl Minderjähriger mit starkem Untergewicht um mehr als ein Drittel angestiegen. "Essstörungen wie Magersucht und Bulimie nahmen um fast zehn Prozent zu", heißt es in der DAK-Studie.

Deutliche Veränderungen seien auch bei Diabetes- und Asthma-Erkrankungen sowie Infektionen zu verzeichnen gewesen, so der aktuelle Kinder- und Jugendreport der DAK.

10.09.2021 17:16:00 [Der Freitag]
Teurer Müll
Die Industrienationen haben einen Großteil der Corona-Impfstoffe aufgekauft. Nun schmeißen sie ihn wieder weg, weil die Verträge eine Weitergabe verbieten. Kennen Sie die Geschichte vom Kind, das seine Osterhasen auf dem Fenstersims hortet und sie erst, als sie in der Sonne wegschmelzen, halb verdorben an andere Kinder verteilt? So ähnlich geht es derzeit zu bei den Corona-Impfstoffen. Die reichen Länder haben sich das Gros gesichert, nun liegen die Dosen wie Blei in Impfzentren und Arztpraxen, ihre Haltbarkeit läuft ab, oder sie mussten schon entsorgt werden, weil sie nicht beziehungsweise nicht mehr nachgefragt werden.
10.09.2021 18:55:07 [RT DE]
Corona-Immunität: Wieder Hände schütteln und soziale Kontakte zulassen
"Wir können das Virus nicht wegzaubern, mit keiner Maßnahme." Das hat der Schweizer Infektiologe Pietro Vernazza in einem Radio-Interview mit dem Sender SRF am Dienstag erklärt. Er sprach sich dabei gegen zu einfaches Denken in der Pandemie aus. Vernazza vermutet, dass die Anti-Corona-Maßnahmen seit anderthalb Jahren das Immunsystem der Menschen geschwächt haben. Das sieht er als möglichen Grund dafür, dass die als "Infektionszahlen" bezeichneten positiven Testergebnisse auf SARS-CoV-2 sowie Krankenhausbehandlungen wegen COVID-19 in der Schweiz und anderen Ländern im Sommer überraschend gestiegen sind.
11.09.2021 09:30:08 [ScienceFiles]
COVID-Impfung: Herzerkrankung wahrscheinlicher als Schutz vor COVID-19
Eigentlich vergeht kein Tag, an dem wir uns nicht verwundert die Augen reiben.
Betrachtet man die Häufigkeit von Nebenwirkungen, die nach Impfung allein in der Datenbank der WHO erfasst werden, einer Datenbank, von der wir begründet den Verdacht haben, dass Meldungen verzögert und unvollständig erfolgen, dann reibt man sich schon anhand der schieren Zahl die Augen: 1.9 Millionen Meldungen von Nebenwirkungen nach Impfung sind derzeit erfasst, eine enorme Zahl, hinter der sich eine Vielzahl schwerer Erkrankungen, von der Erblindung über das Guillain-Barré-Syndrom bis zum Schlaganfall verbergen.

11.09.2021 12:19:02 [Telepolis]
Lockdown oder Triage?
Gebannt stellt man fest, dass die Zahl der Hospitalisierungen von Covid-Patienten gegen Ende des Sommers wieder zunimmt. Nachdem die Inzidenzen als Grundlage der Coronamaßnahmen von den Hospitalisierungsinzidenzen abgelöst wurden, hofft die Politik, zumindest etwas Zeit gewonnen zu haben. Der Preis dafür ist das Risiko, dass man die Auslastung der Krankenhäuser nicht mehr vorhersagen kann, weil erst die Fakten zählen.

Die Hospitalisierungsinzidenz ist die aktuelle Messlatte für Maßnahmen zur Kontaktbeschränkung. Man hat damit die Beurteilung der aktuellen Situation auf der Zeitschiene nach hinten verlegt, in der Hoffnung, dass viele Geimpfte nicht oder nicht symptomatisch erkranken.

11.09.2021 17:37:29 [Anderwelt Online]
In Englands Krankenhäusern sterben die Geimpften
Es ist eine unbewiesene Behauptung, Geimpfte könnten einen milderen Krankheitsverlauf erwarten, wenn sie doch an Covid erkranken. Die jüngste Statistik aus England belegt jetzt das Gegenteil.

Zunächst muss die Frage in den Raum gestellt werden, welchen Sinn eine Impfung haben kann, wenn man sich danach immer noch die Krankheit einfangen kann, gegen die man doch angeblich fortan geschützt sein soll. Mehr noch, wenn man diese Krankheit auch noch übertragen kann – an Geimpfte und Ungeimpfte. Das Argument, man könne als Geimpfter einen milderen Krankheitsverlauf erwarten, wäre gerade noch einzusehen. Die Corona-Statistiken aus England pulverisieren aber gerade auch dieses Märchen der Impfkampagnen.

12.09.2021 07:26:22 [Laufpass]
Geimpft, gehofft und doch verloren
Die Flüssigkeiten, die wir Impfstoffe nennen sollen, funktionieren nicht. Die Daten aus den USA, Island, Israel und anderen Ländern belegen, dass keine echte Immunisierung stattfindet. Die gibt es nur auf natürliche Weise – durch Infektion. Die dabei erworbene Immunität hält dauerhaft und wirkt auch gegen alle „Mutationen“. Anders bei den „Geimpften“: Gespritzte sind ansteckend wie Ungespritzte, werden krank und können sterben. Auch der dritte Schuss ist ein Schuss in den Ofen. Das „solidarische“ Opfer der Impfbereiten war sinnlos. Sie haben sich eine Flüssigkeit spritzen lassen, die nichts taugt – aber mit Sicherheit hohe Risiken birgt, wie auch die Hersteller freimütig einräumen. Mit diesem Fiasko ist für Diskriminierung der Ungespritzten kein Raum mehr da. Sie sind am Ende die gesünderen Menschen.
12.09.2021 09:50:55 [ScienceFiles]
Infektionen mit mehr als einer SARS-CoV-2-Variante sind die Regel
Die derzeit zur Anwendung kommenden Impfstoffe sind alle auf das Spike-Protein, eine bestimmte Konstellation von Nukleotiden auf dem Spike-Protein ausgerichtet.
Das ist ein größeres Problem, als man vielleicht denkt.
Bisher gibt es nur Bedenken, dass die Impfstoffe dann nicht mehr wirken, wenn eine neue Variante auftaucht.

Indes: Eine neue Studie kommt zu dem Ergebnis, dass bei 11.179 Genomen von SARS-CoV-2, die zwischen dem 30. Dezember 2019 und dem 20. Mai 2020 in GISAID gesammelt wurden, dann, wenn man den Endpunkt am 11. Mai 2020 setzt, jeder Patient, von dem das SARS-CoV-2 Genom über in der Regel Abstriche gewonnen wurde, mit mindestens ZWEI verschiedenen Varianten von SARS-CoV-2 infiziert war.

12.09.2021 09:57:36 [TKP]
Schule und Kinder stellen kein Risiko dar – sie schützen sogar
Die begutachtete Studie wurde am 2. September 2021 im British Medical Jounral (BMJ) veröffentlicht. Das Ergebnis kurz zusammengefasst ist, dass Lehrer und ihre Haushaltsmitglieder zu keinem Zeitpunkt des Schuljahres 2020-21 ein erhöhtes Risiko für eine Krankenhauseinweisung mit Covid-19 hatten, im Vergleich zu ähnlichen Erwachsenen im erwerbsfähigen Alter, auch nicht zu Zeiten, in denen die Schulen vollständig geöffnet waren.

Ausgewertet wurden alle Fälle von Covid-19 bei Erwachsenen im Alter von 21 bis 65 Jahren (n=132.420) und eine Zufallsstichprobe von Kontrollen, die in Bezug auf Alter, Geschlecht abgestimmt waren (n=1.306.566).

12.09.2021 15:39:08 [TKP]
Im August betreffen 73% der Todesfälle Geimpfte bei 71% Impfquote
Die Gesundheitsbehörden in Großbritannien produzieren sehr saubere Statistiken und veröffentlichen die Zahlen im Abstand von jeweils zwei Wochen. Aus dem jüngsten Bericht lässt sich für den August keine wirkliche Schutzwirkung durch die Impfungen mehr erkennen. Die Zahlen in dem Bericht enthalten die gesamte Periode von 1. Februar bis 29. August. Die Impfquote ist in dieser Zeit stark gestiegen, in den ersten Monaten konnten sich logischerweise hauptsächlich Ungeimpfte infizieren. Am 2. Februar hatten gerade mal 0,8% beide Dosen erhalten.
13.09.2021 07:03:42 [Respekt]
Mantel des Schweigens wird über Impfschäden gebreitet
Mag. Andrea Steindl ist Rechtsanwältin in Grieskirchen (OÖ) und Mitglied der Rechtsanwälte für Grundrechte sowie des Außerparlamentarischen Corona Untersuchungsausschusses (ACU) in Österreich. Sie betreut derzeit hauptsächlich Fälle potentieller Schäden durch die Injektion gegen Covid-19 bei Erwachsenen. Wenn nun auch Kinder durchgeimpft werden sollen, wird sie möglicherweise bald auch ganz junge Klienten vertreten. Einer ihrer Kritikpunkte ist die mangelnde Aufklärung der zu impfenden Personen durch die Ärzte. RESPEKT hat Sie dazu interviewt.
RESPEKT: Warum engagieren Sie als Juristin sich gegen die aktuelle Corona-Politik?


13.09.2021 13:44:53 [Telepolis]
Impfung und Ansteckung
Im Januar 2021 stellte Bundesjustizministerin Christine Lambrecht eindeutig klar:

"Solange nicht wissenschaftlich sicher belegt ist, dass die Impfung auch vor einer Weitergabe des Virus schützt, kommt eine unterschiedliche Behandlung von Geimpften gegenüber Nicht-Geimpften nicht infrage." Offenbar ist dies nun wissenschaftlich sicher belegt, denn der Entschluss der (zumindest teilweisen) Rücknahme von Grundrechtseinschränkungen für Geimpfte und auch Genesene stellt die Grundlage für die bundesweite 3G-Regel dar (ebenso wie die teilweise eingeführte 2G-Regel). Das RKI bezieht zu dieser Frage eine klare Stellung.

13.09.2021 15:36:12 [TKP]
Über die langfristige Wirkung von Herzmuskelentzündungen
In einer Reihe von Studien wurde schon das Risiko von Herzmuskelentzündungen insbesondere bei Jugendlichen behandelt. Es ist mittlerweile etabliert, dass das Risiko vor allem bei jüngeren Menschen weit höher als die normal auftretende Rate ist.

Im Juni hat die CDC wie berichtet ihr Myokarditis/Perikarditis-Update veröffentlicht. Sie geben jetzt zu, dass das Risiko nach der zweiten Dosis bei Personen unter 25 Jahren das 200-fache der Hintergrundrate betragen könnte – und dies trotz der Unterberichterstattung.

Die Mitglieder eines CDC-Beratungskomitees bestätigten insgesamt 1.200 Fälle von Herzentzündungen bei 16- bis 24-Jährigen und sagten, dass mRNA-COVID-Impfstoffe einen Warnhinweis tragen sollten.

13.09.2021 15:43:22 [ScienceFiles]
10% der “Impflinge” in ASB-Haus schwer erkrankt
Es ist unglaublich, was derzeit geschieht. Ebenso unglaublich ist es, wie mit dem Leben alter und angeblich besonders von COVID-19 gefährdeter Menschen umgegangen wird. Ärzte, deren Behandlung eigentlich Gesundheit herstellen soll, beteiligen sich derzeit nich nur an einem Massenexperiment, sie sind offenkundig auch vorauseilend tätig und spritzen vor allem denen eine dritte Ladung, die sich in Alten- und Pflegeheimen befinden und unter denen sich sicherlich viele finden werden, die besonders hilfsbedürftig sind, nicht beurteilen können, was mit ihnen angestellt wird, deren Gebrechlichkeit, körperlicher und mentaler Art man ausnutzen also kann, um einen experimentellen Impfstoff ein drittes Mal zu verabreichen, nach dem Motto: Wer bislang nicht gestorben ist, der wird es auch dieses Mal überleben.

Ist aber nicht so.

13.09.2021 17:13:45 [ScienceFiles]
Vitamin D: besser als COVID-19-Impfung?
In jedem Fall billiger.

Um fair zu sein, in diesem Beitrag zeigen wir nicht, dass Vitamin D einen besseren Schutz vor einer Infektion mit SARS-CoV-2 und einer Erkrankung an COVID-19 bietet als eine Impfung. Wir präsentieren die Ergebnisse einer Meta-Analyse, die zeigt, dass das Vitamin D Level in einem positiven Zusammenhang mit einem Schutz vor Infektion und Erkrankung steht. Vor diesem Hintergrund ist der logisch nächste Schritt zur Verbreiterung der wissenschaftlichen Erkenntnis, zu untersuchen, ob der Schutz, den Vitamin D vor Infektion und Erkrankung bietet, dem von Impfstoffen überlegen ist.

14.09.2021 13:08:22 [Telepolis]
G ist nicht gleich G
Die Gruppe der Genesenen findet aktuell kaum Beachtung in der öffentlichen Diskussion. Wie die wissenschaftliche Forschung aber zeigt, ist dies ein Fehler. Bei den sogenannten 3G bzw. 2G-Regeln steht ein G selbstverständlich für Geimpfte. Ein weiteres für Genesene. Zwar erlauben beide Gs den Zugang zum digitalen Impfpass, jedoch mit einem wichtigen Unterschied: Während Geimpfte ein Jahr lang die Vorteile genießen dürfen, fallen Genesene genau sechs Monate nach der festgestellten Erkrankung aus dieser Gruppe heraus und dürfen dann bei einer 2G-Regel draußen vor der Tür bleiben oder bei einer 3G-Regel sich durch einen bald selbst zu bezahlenden Test freitesten.
14.09.2021 13:21:25 [RT DE]
Was zählt der hippokratische Eid in Coronazeiten?
Es gab einmal Zeiten, da standen die Türen der Ärzte all jenen offen, die erkrankt waren. Und, was noch viel wichtiger war, man durfte Hilfe erwarten. Doch das war einmal. Man braucht sie schon gar nicht mehr zu nennen, diese eine Krankheit, der heutzutage alles andere – aber auch wirklich alles – untergeordnet wird. Wer aber in diesen Zeiten mit anderen gesundheitlichen Herausforderungen zu kämpfen hat, wird verstehen, wovon die Rede ist.

In meinem Fall geht es um eine Chemotherapie. Eine "leichte" soll es sein, so wurde mir gesagt, ich könne zu Hause bleiben. Aber dennoch fällt vieles schwer. Und hin und wieder sind die Nebenwirkungen so stark, dass es keinen Alltag gibt. Im konkreten Fall waren dies vor allem starke Ausschläge, Übelkeit, Schwäche und – jetzt kommt's – grippeähnliche Symptome.

14.09.2021 13:24:26 [NachDenkSeiten]
STIKO: Die (Nicht?-)Empfehlung
Die Empfehlung der STIKO zur Impfung von Kindern und Jugendlichen im Alter von 12 bis 17 Jahren gegen Covid-19 wurde von den Medien verbreitet, als sie noch gar nicht in schriftlicher Form vorlag. Wie sie begründet ist, welche Risiko-Nutzen-Abwägung durch welche Studien unterlegt wurde, das konnten Interessierte zu diesem Zeitpunkt noch nicht genauer nachlesen.

Leider haben die meisten Medien auch nicht weiter danach gefragt.

Das mittlerweile erschienene 33. Epidemiologische Bulletin enthält aber keine überzeugenden wissenschaftlichen Begründungen für eine allgemeine Impfempfehlung der 12- bis 17-Jährigen.

14.09.2021 14:43:22 [WOZ - Die Wochenzeitung]
Auffrischimpfung: Ein unnötiger Luxus
Die Diskussion um eine dritte Impfung für die breite Bevölkerung nimmt Fahrt auf. Anfang Woche gab die Europäische Arzneimittelagentur bekannt, sie beschleunige die Prüfung einer solchen Auffrischimpfung mit dem Biontech/Pfizer-Impfstoff. In Israel ist der «Booster-Shot», wie die Pharmafirmen es gerne labeln, bereits seit Ende August für sämtliche Personen ab zwölf Jahren eingeführt. Und die US-Regierung hat angekündigt, so rasch wie möglich nachziehen zu wollen.

Dieser politische Entschluss hat nun zu Verwerfungen geführt. Letzte Woche gaben zwei der ranghöchsten Vertreter der US-Regulierungsbehörde FDA ihren Rücktritt bekannt: Marion Gruber und Philipp Krause begründeten diesen Schritt gemäss der «New York Times» damit, dass die aktuelle Datenlage nicht ausreichend sei, um eine dritte Impfung zu rechtfertigen.

15.09.2021 07:29:57 [Junge Welt]
Langlebige Vorurteile: Diskriminierung macht krank
Die Lebensqualität von Menschen mit HIV wird heutzutage vor allem durch Vorurteile und Diskriminierung eingeschränkt, nicht durch die Infektion selbst. Zu diesem Schluss kommt die Studie »Positive Stimmen 2.0«, die am vergangenen Freitag in Berlin von der Deutschen Aidshilfe (DAH) und dem Institut für Demokratie und Zivilgesellschaft (IDZ) vorgestellt wurde.

Im Rahmen der Erhebung haben Menschen, die selbst HIV-positiv sind, andere Betroffene zu ihrem Alltag mit der Infektion befragt. Das laut den Studienmachern »partizipativ entwickelte und umgesetzte Projekt« vermittele »einen plastischen Eindruck in die Aspekte dieses Lebens jenseits der medizinischen Erfolge«.

15.09.2021 09:33:58 [Ansage!]
Die finale Pervertierung des Arzneimittelrechts
In Deutschland herrschen eigentlich unfassbar hohe Sicherheitsstandards bei Arzneimitteln und Impfstoffen, die noch bis Ende 2020 so konsequent durchgesetzt wurden, dass ohne jahre-, teilweise jahrzehntelange Tests eigentlich kein Produkt zur Marktreife gelangen konnte. Alles wurde dafür getan, Fehlmedikationen zu verhindern. Die Rezeptpflicht galt stets als heilig, härteste Strafen drohten illegalen Importeuren von medizinischen Präparaten und Wirkstoffen. Neue Impfungen wurden nur mit Vollzulassung, nach langjährigen Studien und Testreihen genehmigt und ausschließlich – mit Ausnahme von standardisierten Kinder-Schluckimpfungen oder beim Militär – bislang stets in Arztpraxen, von persönlich bekannten Vertrauensärzten verabreicht.
15.09.2021 09:37:06 [TKP]
„Es gibt keine medizinische oder epidemiologische Rechtfertigung für den Covid-Pass“
Manchmal ist es ungünstig Gespräche vor einem eingeschaltetem Mikrophon zu führen, die nicht für die Öffentlichkeit bestimmt sind. Israels Gesundheitsminister sagte einem Kollegen auf eine Frage zum Grünen Pass, dass der Zweck des Passsystems lediglich darin bestehe, die Bürger unter Druck zu setzen, damit sie sich impfen lassen.

Die Äußerungen wurden vom israelischen Nachrichtensender Channel 12 News in einem offenen Gespräch zwischen Gesundheitsminister Nitzan Horowitz und Innenministerin Ayelet Shaked vor einer wöchentlichen Sitzung des israelischen Kabinetts am 12. September aufgezeichnet.

Horowitz und Shaked wussten nicht, dass der Sender ihr Gespräch aufzeichnete und ausstrahlte.

15.09.2021 12:15:07 [NachDenkSeiten]
„Infektion“ oder „Booster-Immunisierung“?
Eine absurde Debatte legt die Sinnlosigkeit der deutschen Corona-Politik offen. In seinem NDR-Podcast vom letzten Freitag wirft der Virologe Christian Drosten einen Blick auf die Zukunft der Corona-Pandemie. Corona, so Drosten, könne schon bald eine „normale“ Krankheit werden, wenn die Bevölkerung eine weitgehende Immunität entwickelt hat. Ein Satz von Drosten lässt dabei besonders aufhorchen. Denn der Virologe sieht in einer Infektion für Doppel-Geimpfte keinesfalls ein Problem; im Gegenteil. Diese Infektionen sind das, was er eine „Booster-Immunisierung“ nennt; also eine zusätzliche Immunisierung, die das Immunsystem nahezu perfekt trainiert. Das ist interessant, denn wenn man diesen Gedanken zu Ende denkt, fragt man sich unweigerlich, wer durch die Maßnahmen überhaupt wovor geschützt werden soll.
15.09.2021 13:50:57 [TKP]
Der Varianten Poker mit den mRNA Impfstoffen
Es ist wirklich erstaunlich wie stark der Druck auf die Ungeimpften gesteigert wird sich impfen zu lassen, vor allem mit den mRNA Impfstoffen. Diese bergen gleich mehrere Gefahren, die aber immer wieder geflissentlich ignoriert werden. Deshalb hier nochmals Hintergründe dieser Gefahren.

Da ist zunächst die gezielte Selbstverletzung des Körpers. Klassische Impfstoffe präsentieren dem Immunsystem abgetötete oder stark abgeschwächte Exemplare des Virus oder der Bakterien, gegen die man Immunität erzeugen möchte. Die Technologie der gentechnischen Präparate ist aber anders und völlig neu.

15.09.2021 17:33:00 [Politica-Comment]
Dritte Covid-Impfung nötig?
Der Biontech- Gründer Ugur Sahin erklärte in einem Interview mit dem SPIEGEL vom 11.9. 2021 :

“Ich rechne damit, dass in den nächsten Wochen viele Studiendaten kommen, die statistisch valide belegen, wie wichtig diese Boosterung (Dritte Covid Impfung) ist. Das israelische Gesundheitsministerium hat Daten veröffentlicht, die zeigen, dass nach einer Dritten Impfung der Schutz vor einer Infektion mit Delta bei über 95% liegt.”

Verständlich, dass der Biontech-Chef eine Boosterung (Auffrischimpfung) empfiehlt, schliesslich leitet er eine Firma die Gewinne machen soll, und keinen Wohltätigkeitsverein. Aber er befindet sich in “guter” Gesellschaft.

15.09.2021 19:12:45 [TKP]
1-/2-/3G und der Impfpass
Für den Herbst sind insbesondere in Deutschland und Österreich wieder verschärfte Maßnahmen geplant, während Länder wie Dänemark und Schweden die Pandemie und alle Maßnahmen beendet haben. Alles zielt darauf ab, noch mehr Menschen zur Impfung zu treiben, der Impfbus kommt sogar in die Schule. Auch wenn das Risiko der Impfung weit höher als die Gefährdung durch eine Infektion ist – wie bei Kindern und Immunen – muss geimpft werden. Gerne wird behauptet, dass Anfang 202 niemand wissen konnte, wie mit dem „neuartigen“ Coronavirus umzugehen sei, wie gefährlich es ist. Aber Wissenschaftler wie Nobelpreisträger Michel Levitt, oder der Nummer-1-Medizinwissenschaftler John P.A Ioannidis errechneten schon sehr rasch eine Infektionssterblichkeitsrate von 0,125%.
16.09.2021 06:52:53 [Novo Argumente]
War Willy Brandt ein Massenmörder?
In der alten Bundesrepublik wurden tödliche Atemwegspandemien, die Asiatische und die Hongkong-Grippe, weitestgehend ignoriert. Das war der vernünftigere Weg.

„Es gab einmal eine Zeit, in der die Menschen zu wenig Angst hatten, und dies musste geändert werden.“

„Die Hongkong-Grippe schleicht sich auch in die Bundesrepublik ein“, schrieb Anfang 1969 die Koblenzer Rhein-Zeitung. „In Schweden, der Sowjetunion, Großbritannien wurde längst Grippealarm gegeben. Auch die deutschen Ärzte fürchten die grassierende Krankheit“. In New York City waren Krankhäuser überfüllt, Pavarotti brachte in der Met nur ein Krächzen hervor.

 Konzerne, Unternehmen, Monopole, Organisationen, Vereine, Lobbyismus, Korruption (13)
01.09.2021 06:35:09 [Tagesschau]
Amazon meist nicht billigster Anbieter
Nahezu jeder deutsche Online-Kunde kauft auch bei Amazon ein. Viele sind überzeugt, dass Sie zu niedrigen Preise beim kundenfreundlichsten Branchen-Primus aus Seattle bestellen. Ob das wirklich so ist, hat die SWR-Verbraucherredaktion marktcheck überprüft. Fünf Wochen lang beobachtete der Experte für Marktbeobachtung und Preisoptimierung, Tobias Schlögel, im Auftrag der SWR-Journalisten 816 Topseller von Amazon, darunter viele Markenprodukte. "Wenn man jetzt die Daten der letzten fünf Wochen entsprechend heranzieht, können wir mit dem Mythos aufräumen, dass Amazon der günstigste Anbieter ist", fasst der Preis-Experte das Ergebnis zusammen.
06.09.2021 07:30:12 [Heise]
Lobbyschlacht: Was sich Google & Co den Kampf gegen EU-Regeln kosten lassen
612 Unternehmen, Vereinigungen und Wirtschaftsverbände versuchen, die Politik der EU im Bereich digitale Wirtschaft mit ihrer Lobbyarbeit zu beeinflussen. Dafür geben sie pro Jahr aktuell mehr als 97 Millionen Euro aus und beschäftigen insgesamt 1452 Lobbyisten. Dies geht aus einer Studie zur "Lobbymacht von Big Tech" hervor, die die beiden zivilgesellschaftlichen Organisationen LobbyControl und Corporate Europe Observatory (CEO) am Dienstag veröffentlicht haben.

Die IT-Branche hat demnach die höchsten Lobbyausgaben in der EU, noch vor der Pharmaindustrie, Erdöl- und Erdgaskonzernen, der Finanzwirtschaft und der Chemiebranche.

08.09.2021 13:36:43 [Abgeordnetenwatch]
Sigmar Gabriel lobbyierte bei Merkel für die Deutsche Bank
Im April 2020 geht ein streng vertrauliches Schreiben ("Strictly Confidential") im Bundeskanzleramt ein, das mit einer Schmeichelei beginnt: "Liebe Frau Bundeskanzlerin, herzlichen Dank für das Telefonat heute morgen. Ich bin ehrlich gesagt ziemlich froh, dass Sie gerade 'an Deck' sind." Verfasser der Fanpost ist kein Parteifreund von Angela Merkel, sondern ein langjähriger Kontrahent: Ex-SPD-Chef Sigmar Gabriel.

Der frühere Minister und Vizekanzler hat an diesem Frühlingstag allen Grund, den kurzen Draht zur Kanzlerin zu aktivieren. Einige Wochen zuvor war er als Mitglied im Aufsichtsrat der Deutschen Bank nominiert worden. Die hat nun ein wichtiges Anliegen – und Merkel soll helfen.

08.09.2021 18:57:35 [LobbyControl]
Lobbyreport 2021: Beispiellose Lobbyskandale – und strengere Regeln
Lobby- und Korruptionsskandale haben der Demokratie in dieser Legislaturperiode schweren Schaden zugefügt. Insbesondere die Maskenaffäre und die Aserbaidschan-Verstrickungen in der Union haben gezeigt, wie nötig schärfere Regeln für mehr Lobbytransparenz und Integrität in der Politik sind. Unter dem Druck der Skandale ist die Große Koalition immerhin wichtige Schritte in diese Richtung gegangen. Zu diesem Befund kommt der heute vorgestellte Lobbyreport 2021 von LobbyControl. Der Bericht bewertet die Politik in fünf Bereichen wie Parteienfinanzierung, Lobbytransparenz oder Abgeordnetenregeln.
09.09.2021 17:17:01 [Zeit Online]
Wie Sigmar Gabriel für die Deutsche Bank lobbyierte
Nach dem Verlust der Macht lockt das Geld. Mehrere frühere Minister setzten sich für Unternehmen und Verbände bei der Bundesregierung ein, zeigen vertrauliche Dokumente. Die Mail beginnt wie Fanpost an Angela Merkel: "Liebe Frau Bundeskanzlerin, herzlichen Dank für das Telefonat heute Morgen. Ich bin ehrlich gesagt ziemlich froh, dass Sie gerade ‘an Deck’ sind." Hier schmeichelte im Frühjahr 2020 jedoch kein JU-Ortsvorsitzender seinem politischen Idol, sondern ein früherer politischer Gegner der Kanzlerin: Sigmar Gabriel.

Zwei Jahre zuvor war der ehemalige SPD-Vorsitzende noch Vizekanzler und damit Merkels Stellvertreter gewesen.

10.09.2021 09:53:46 [Telepolis]
Gekaufte Politiker: Korruption und Lobbyismus in Deutschland
Die Aussage ist hart: Unter anderem die Christdemokraten haben in der zurückliegenden Legislaturperiode das Vertrauen in die Demokratie schwer beschädigt. Dieser Vorwurf wird von der Organisation Lobbycontrol erhoben, die jetzt ihren Lobbyreport 2021 vorgestellt hat. Aber auch anderen bürgerlichen Parteien kann dieser Vorwurf gemacht werden.

Dass Politiker käuflich sind, sich für die Interessen der Wirtschaft stark machen und als Gegenleistung von ihren Klienten viel Geld erhalten; dass sie sich in Notzeiten bereichern - das sei kein Einzelfall oder das Fehlverhalten einzelner Abgeordneter, heißt es in dem Bericht weiter.

10.09.2021 13:16:05 [RT DE]
Ex-Politiker als Türöffner für Konzerne und Verbände
Es sind für Lobbyismus bereits bekanntere Namen wie Karl-Theodor zu Guttenberg (CSU), die ihre Kontakte in die Bundesregierung für Anliegen der Wirtschaft genutzt haben, aber auch Sigmar Gabriel (SPD), Franz Josef Jung (CDU), Rainer Brüderle (FDP) oder Philipp Rösler (FDP). In der noch laufenden Legislaturperiode waren wieder mehrere Minister a.D. aus früheren Legislaturen nah an ihren früheren Arbeitsplätzen aktiv und haben so wohl die Anliegen ihrer Arbeitgeber aus der Privatwirtschaft ganz nach oben in die Bundesregierung getragen.

Dass Minister nach dem Ende ihrer Amtszeit für die Wirtschaft tätig werden, scheint eine klassische Win-Win-Situation für diese beiden Seiten, wenn auch nicht für die Demokratie.

10.09.2021 15:26:56 [NachDenkSeiten]
Wie Big Tech in der EU Politik für sich selber macht
Hinter den Kulissen der EU-Institutionen tobt eine heftige Lobbyschlacht. Um eine weitgehende Regulierung der Geschäftsfelder der großen Digitalkonzerne zu vereiteln, bieten Google, Facebook, Apple und Co. alles auf, was Geld, Macht und Einfluss hergeben. Nach einer Studie der Initiative LobbyControl macht die Branche dafür jährlich fast 100 Millionen Euro locker – mehr als jeder andere Wirtschaftssektor. Die wichtigsten Akteure sind die Tech-Unternehmen selbst, gesponserte Verbände, Denkfabriken und PR-Agenturen. Gemeinsam trällern sie das Lied von einer heilen Welt der Bits und Bytes und bestimmen so das Grundrauschen des politischen und medialen Betriebs.
13.09.2021 17:15:26 [Legal Tribune Online]
Mon­santo ist Bayers größte Ner­ven­säge
Am 14. September 2016 war Bayer endlich am Ziel. Nach monatelangem Feilschen akzeptierte der US-Saatgutriese Monsanto das über 60 Milliarden Dollar schwere Übernahmeangebot des Leverkusener Agrarchemie- und Pharmakonzerns. Bayer-Chef Werner Baumann schrieb Geschichte - er wagte den größten Zukauf, den je ein deutsches Unternehmen im Ausland stemmte. Doch fünf Jahre später fällt die Bilanz ernüchternd aus. Klagewelle, Imagekrise, Milliarden-Risiken, Rekordverlust - Monsanto bereitete Bayer bislang wenig Freude, dafür aber reichlich Probleme. Die Folgen des Mega-Deals machen dem Konzern weiter zu schaffen.
14.09.2021 14:33:37 [Tagesschau]
Wie Lobbyisten im Wahlkampf mitmischen
Viele Interessengruppen versuchen, den Ausgang der Wahl zu beeinflussen. Eine wirtschaftsnahe Organisation schaltet Anzeigen gegen Grünen-Kandidatin Baerbock, Klimaaktivisten lassen Fake-Plakate gegen die CDU aufhängen. "Alle reden vom Klima. Wir ruinieren es" - so steht es auf Anzeigen, die mit dem Logo der CDU versehen sind, aber natürlich nicht von der CDU stammen. Vielmehr haben radikale Klimaaktivisten von "Extinction Rebellion" zugeschlagen. "Adbusting" nennt sich das, was man mit "verfremdeter Werbung" übersetzen kann. Zuvor hatte die vor allem von Wirtschaftsverbänden finanzierte "Initiative Neue Soziale Marktwirtschaft" Anzeigen gegen Annalena Baerbock geschaltet.
14.09.2021 16:36:31 [Telepolis]
Volkswagen will bei Software "Bündnis" gegen Konkurrenz
Im Kampf mit dem US-amerikanischen E-Autobauer Tesla vermeldet Volkswagen einen scheinbaren Erfolg: Die Wolfsburger beginnen noch in dieser Woche im großen Stil mit dem drahtlosen Versenden von Software-Updates "over the air" (OTA). Was für VW eine Herkules-Aufgabe ist, ist für Tesla ein alter Hut: Der US-Konzern hat schon vor acht Jahren damit begonnen.

Software ist auch für Volkswagen ein Geschäft, mit dem sich erhebliche Umsätze generieren lassen. VW-Vertriebsvorstand Klaus Zellmer sprach dem "Handelsblatt" zufolge zuletzt davon, mit zusätzlicher Software Umsätze im dreistelligen Millionenbereich machen zu wollen.

15.09.2021 11:45:42 [Tagesschau]
Diesel-Skandal bei VW: "Ich habe nicht die ganze Wahrheit gesagt"
"Ich habe den US-Behörden nicht alles gesagt, was ich wusste. Das wurde mir zum Verhängnis", so beschreibt Oliver Schmidt, der ehemalige Leiter des VW-Umweltbüros in den USA, seine Rolle im VW-Diesel-Skandal. In einem Interview mit dem NDR behauptet der Ex-VW-Manager, er habe im Sommer 2015 von VW den Auftrag erhalten, mit den US-Umweltbehörden zu verhandeln. Dabei sollte er bestimmte Worte nicht verwenden. Insbesondere sollte er bei der Beschreibung der Softwarefunktion zur Abgasbehandlung, die in den VW Dieselfahrzeugen verbaut war, nicht von "defeat device" sprechen, also einer illegalen Testerkennung.
15.09.2021 19:05:09 [Netzpolitik]
Google will Risiko durch KI „nicht überbetonen“
Ein wegweisendes Gesetz soll es werden, die Künstliche-Intelligenz-Verordnung der Europäischen Union. Da überrascht es kaum, dass offenbar bis zur letzten Minute deswegen lobbyiert wurde.

Nur wenige Wochen vor der offiziellen Vorstellung des Gesetzesvorschlags im April dieses Jahres trafen Google-Vertreter die EU-Kommission, um für die Interessen des Konzerns zu werben. Der Entwurf beschäftigt sich vor allem mit Hochrisiko-Anwendungen von Künstlicher Intelligenz (KI). Noch vor Jahresende soll er um einen weiteren Gesetzesvorschlag ergänzt werden, der Haftungsfragen zum Gegenstand hat. Das EU-Parlament hatte gefordert, sowohl Hersteller als auch Anbieter von KI-Tools in die Pflicht zu nehmen.

 Ansichtssache, Meinung, Kommentare, Diskussion, Debatte, Hintergrund, Verschiedenes (95)
01.09.2021 06:37:48 [Free21]
Wuhan, Biowaffen und „Das große Abkoppeln“
Was sagen Sie zu dem mutmaßlichen Ausbruch der Krankheit in Wuhan?

In den letzten beiden Dezembertagen 2019 wurden die Krankenhäuser in Wuhan vom örtlichen CDC (Center for Disease Control and Prevention) darüber informiert, dass ein Virus aufgetreten ist, welches höchstwahrscheinlich mehrere Fälle von Lungenentzündung erklärt. Die Krankenhäuser vermuteten daraufhin, dass dieses Virus von einem Fischmarkt stammte, auf dem auch einige Wildtiere verkauft wurden. Mehrere Patienten hatten Kontakt mit diesem Markt. Ein Dutzend Fälle von Lungenentzündung in einer Stadt mit 11 Millionen Einwohnern war jedoch nichts Ungewöhnliches.

01.09.2021 08:56:37 [Fassadenkratzer]
Wer die Altparteien wählt, wählt den Totalitarismus
Die meisten sehen nicht die brennenden Schriftzeichen an der Wand. Die tägliche mediale Lügen-Berieselung taucht ihr Bewusstsein in einen träumenden Zustand. Sie halten in ihrer Autoritäts-Gläubigkeit und Obrigkeitshörigkeit die Grundrechts-Einschränkungen für vorübergehend und sehen nicht, wie weit der Totalitarismus hinter formal-demokratischen Schleiern bereits Realität geworden ist und weiter etabliert werden wird. Wenn es nicht gelingt, bis zur Bundestagswahl noch eine genügende Zahl von Menschen aufzuwecken, so dass diese totalitäre Parteien-Kaste abgewählt wird, wird sie sich vom Volk legitimiert fühlen – und es wird kein Zurück mehr geben.
01.09.2021 08:57:31 [Polit Platsch Quatsch]
Knapp geklappt: Rückzug zum Weltfriedenstag
Ein Tag für Dunkeldeutschland, ein Tag, der die tiefe Kluft noch einmal zeigt, die auch nach 31 Jahren Gemeinsamkeit mitten in Deutschland klafft. Der Weltfriedenstag, in der hässlichen Zeit der Teilung in der DDR als „Tag des Friedens“ oder „Weltfriedenstag“ begangen und in der Bundesrepublik aus purer Quertreiberei kontrafaktisch „Antikriegstag“ genannt, als sei Frieden nicht Antikrieg, existiert im vierten Jahrzehnt neugewonnener Gemeinsamkeit ausschließlich noch dort, wo der Brauch früher ein staatlicher war.

Gegenüber im Reich der Freiheit und des Lichts dagegen sieht niemand keinen Anlass, nicht zu feiern.

01.09.2021 09:00:26 [Ansage!]
Great Reset oder spätrömische Dekadenz?
Die Theorie eines großen destruktiven Planes, der als Schatten über der Welt schwebt, erfreut sich unter aufgewühlten Bürgern einer immer größeren Beliebtheit. Klar, sie hat den großen Vorteil, dass inmitten eines komplexen, kaum noch zu durchdringenden Bedingungsgefüges wieder klare Fronten sichtbar werden. Es gibt Gut und Böse, Arm und Reich, eindeutige Feindbilder und damit eine universell gültige Erklärung für das wachsende Ungemach auf der Welt. Die Gegenthese von der auf breiter Front voranschreitenden „spätrömischen“ Dekadenz geht eher davon aus, dass der Zenit der westlichen Hemisphäre weniger geplant, sondern auf eher evolutionsbiologische Weise überschritten wurde.
01.09.2021 10:56:26 [Peds Ansichten]
Oft ist es nicht so, so wie es scheint
Und so trügt auch der Schein, dass eine gelähmte Bevölkerung dem enthemmten Treiben der Regierungen tatenlos zusieht.

So stellen es natürlich die Mächtigen und die an ihnen klebenden Sprachrohre absichtsvoll dar: Eine „verstrahlte, unsolidarische, aber vergleichsweise vernachlässigbar kleine Herde von Corona-Leugnern“ wäre als kleine Minderheit längst ausgegrenzt. Und der Rest rennt brav von einer Diskriminierung in die nächste und lässt sich dabei gläubig irgendwelchen Dreck in den Körper spritzen. Aber dem ist nicht so!

01.09.2021 12:28:40 [Polit Platsch Quatsch]
Corona: Rücksichtslose Rechenspiele
Er heißt Marcel Barz, ist von Beruf Informatiker und seit seiner Jugend begeistert von Mathematik. In der Pandemiezeit erging es Barz wie vielen: Kaum kam das Thema mit dem großen C auf, wurden Diskussionen ungemütlich, unerbittlich und unversöhnlich. Die Impffrage, eine Glaubenssache, spaltet Freundeskreise und entzweit sogar Familien, weil sie zu einer individuellen Entscheidung über das Schicksal der Nation erklärt worden ist. dass irgendetwas nicht stimmen kann, wenn eine Impfung eigentlich den Geimpften schützt, der aber nur wirklich geschützt sein soll, wenn sich alle impfen lassen haben, spielt keine Rolle - ebenso wenig wie all die Zahlen, Daten und Fakten, die Marcel Barz beim Versuch aufgearbeitet hat, einen guten Freund, der Corona hartnäckig leugnet, mit Hilfe "der Wissenschaft" von Ausmaß und Auswirkungen der Pandemie zu überzeugen.
01.09.2021 15:40:37 [Anderwelt Online]
Impfen oder AfD? Was hilft gegen Corona?
Betrachtet man die „Inzidenz-Karte“ für Corona in Deutschland fällt auf, dass die Inzidenzen in den „neuen Bundesländern“ deutlich niedriger sind als im Westen. Dazu gibt es im Osten zwei weitere Auffälligkeiten: Die Impfquoten sind niedriger und die AfD ist stärker. Darf man da einen Zusammenhang sehen?

Weltweit verfestigt sich ein Trend: Länder mit den höchsten Impfquoten melden die höchsten Inzidenzen. Gibraltar, Island, Israel. Innerhalb Deutschlands ist das auch zu beobachten, obwohl die Quotenunterschiede nicht besonders auffällig sind. Sie reichen von 51,8 (Sachsen) bis 70,1 (Bremen). Alle neuen Bundesländer liegen unter 60 Prozent, mit Ausnahme von Berlin.

01.09.2021 17:44:52 [Ansage!]
Entweder geimpft und gesund – oder todgeweiht?
In Israel braucht es jetzt schon drei statt bisher zwei Dosen, um den Status "voll geimpft" zu behalten. Nicht nur der gesunde Menschenverstand, auch sprachliche Präzision und der Sinngehalt von Schlüsselbegriffen sind in dieser Pandemie unter die Räder gekommen: Mit Blick auf über 1,7 Millionen an Krebs, über 10 Millionen an Herz-Kreislauf-Erkrankungen, über hunderttausend dauerhaft an HIV und Hepatitis C oder weiteren Virenerkrankungen, sowie einer Vielzahl an sonstigen, oft tödlichen Gebrechen leidenden Deutschen ist es geradezu eine Frechheit und Vermessenheit, dass Ausdrücke wie „genesen“ und „erkrankt“ praktisch nur noch und exklusiv für Corona verwendet und – exklusiv für dieses Monothema – im Sprachgebrauch inflationär verankert werden.
01.09.2021 18:01:33 [Rubikon]
Die Impfnötigung
„Niemand hat die Absicht ...“ Ein solcher Halbsatz versetzt geschichtsbewusste Menschen in Alarmstimmung. Folgt auf diesen doch seit Walter Ulbricht meist genau das, was vehement geleugnet wurde. So hat 2021 niemand die Absicht, eine Impfpflicht zu erlassen. Doch sind die Einschränkungen, die Ächtung und Ausgrenzung, denen Ungeimpfte ausgesetzt sind, so immens und lebensbedrohlich, dass daraus de facto ein Impfzwang erwächst. Die Notwendigkeit hierfür wird von den Befürwortern mit moralischen Argumenten unterfüttert. Genau dieser Personenkreis trägt jedoch häufig eine unethische Haltung zur Schau, die zum Beispiel auf der Kurznachrichtenplattform Twitter menschenverachtende Blüten treibt.
01.09.2021 19:15:32 [Tichys Einblick]
Die internationale Anerkennung der Taliban ist schleichend im Gange
Vor einigen Tagen erst wurde öffentlich, dass die USA sich auf die Taliban bei der Sprengstoffkontrolle am Kabuler Flughafen verließen – bevor dann bei einem Anschlag 13 US-Marines getötet wurden. Doch damit nicht genug: Wie CNN jetzt berichtet, setzt die US-Regierung weiter auf die Unterstützung der Taliban – man teilte Geheimdienstinformationen über den Aufenthaltsort von US-Staatsbürgern und ließ die Taliban diese dann zum Flughafen eskortieren. Was die Gegenleistung ist, ist bisher nicht bekannt.

Die Taliban bemühen sich dieser Tage darum, sich ein legitimes Image zu verschaffen.

06.09.2021 06:26:01 [Gift am Himmel]
Drei zur Zerstörung Amerikas benutzte Massentraumata
Die Verwendung der aus (auch als These, Antithese, Synthese bekannten) Problem, Reaktion , Lösung bestehenden Hegeleschen Dialektik hat der herrschenden Elite als schablonenartiges Drehbuch für ununterbrochene Gewalt, Tod, weltweite Destabilisierung und die Vertiefung der menschlichen Versklavung durch die ununterbrochene Fortführen von Anschlägen unter Falscher Flagge als Antwort der Kabalen auf jedes von ihnen wahrgenommene Problem und die verdeckten Katastrophen durch Kriege der Banker, staatlich geförderten Terrorismus, Wirtschaftseinbrüche, Attentate und Umstürze, bis hin zu der heute propagierten Viruspandemie als projizierte Gefahr und Bedrohung gedient, die als ursächliche Reaktion auf das falsch identifizierte Problem auftritt.
06.09.2021 06:29:54 [Johannes Loew]
Und nun?
Der Westen ist weg. Die Amerikaner sind weg. Den Flughafen von Kabul haben sie hinterlassen, als habe dort eine Horde Mastschweine getobt. Es heißt, man steht mit Qatar kurz vor Vertragsabschluss für dessen Wiederaufbau.
Heiko Maas war noch auf Tournee geflogen, um die Nachbarländer Afghanistans in Flüchtlingslager umzuwandeln, was er als „Deutschland lässt euch nicht im Stich!“ zu verkaufen versuchte, die winkten dankend ab. Man durchschaut die bellizistischen Ambitionen des deutschen

06.09.2021 06:31:23 [Meine Meinung Meine Seite]
Die „Ortskräfte- Story“
Seit die Taliban in Afghanistan de facto die Macht übernommen haben, gackern die EU- Häuptlinge wie aufgescheuchte Hühner nur mehr von der "Rettung von Ortskräften", von "Evakuierungen", von "Menschen vor den Taliban retten" usw. Alle, nein, fast alle wollen tausende, zehntausende, am liebsten hunderttausende Afghanen in die EU retten. Natürlich auch Richterinnen, Reporterinnen, Menschenrechtlerinnen. Und Mädchen und Frauen. Eigentlich soll, wenn es nach diesen "Guten" geht, Afghanistan z
06.09.2021 07:41:04 [M 7]
Sic transit Gloria mundi
In meiner Zeit in Südostasien, 12.000 Km entfernt von meinem eigenen Land, wurde ich immer wieder gefragt, wie denn die Menschen bei mir zuhause lebten. Es interessierte, welche Vorlieben sie hätten, wie sie wohnten, wo und wie lange sie arbeiteten und was sie verdienten, wie groß die Familien waren und ob sie zusammen lebten, was sie machten, wenn sie frei hätten, ob und welchem Glauben sie anhingen und ob sie ihr Land liebten. Von letztem, das muss dazu gesagt werden, gingen die Fragenden immer aus, denn sie selbst, Bewohner eines großen Landes, das vor allem eines gemeinsam hatte, nämlich eine dreihundertjährige Kolonialgeschichte, für das sie, trotz vieler gravierender Probleme, immer ihr letztes Hemd gegeben hätten.
06.09.2021 09:13:26 [Polit Platsch Quatsch]
Böhmermann: Keinen Meter den Menschenfeinden
Es ist ein wuchtiger Aufruf, den der beliebte Entertainer Jan Böhmermann da im Rahmen einer Diskussion beim Hamburger Wochenblatt "Die Zeit" ins Land geschickt hat. Warum noch, warum überhaupt Leute ins Fernsehen lassen, die Ansichten formulieren, aus denen die Menschenfeindlichkeit nur so tropft? Böhmermann, der wegen hoher Einschaltquoten in den Bionadeadelvierteln der Republik als moralische Instanz gilt, ließ dem Talkmaster Markus Lanz keinen Ausweg: Mit der Einladung "von so Leuten wie Hendrik Streeck und Alexander Kekulé, wo man fachlich wirklich sagt, das ist keine gute Idee" schade Lanz dem Kampf für eine allumfassende Einheitsmeinung und das wiederum torpediere alle Anstrengungen, Teile der Bevölkerung nicht zu beunruhigen.
06.09.2021 11:07:48 [Friedensblick]
Impfkampagne in Israel: Nur wirkungslos oder infektionsverstärkend?
Der (Ex-)Impf-Weltmeister hat ein lästiges Wirksamkeits-Problem: Rund 60 Prozent der israelischen Bevölkerung sind vollständig geimpft, rund 40 Prozent nicht. Da bei den Covid-19-Patienten in israelischen Krankenhäusern das Verhältnis ebenfalls bei 60 : 40 liegt, sieht es so aus, „als schützten die Vakzinen nicht mehr“. Das sei falsch und lenke vom tatsächlichen Problem ab, will SPIEGEL-Autorin Julia Merlot in einer „Analyse“ ihren Lesern weismachen. Man ahnt es, das tatsächliche Problem ist für sie die immer noch zu geringe Impfquote und die in Israel bereits seit längerem stark gesunkene Bereitschaft, sich impfen zu lassen.
06.09.2021 11:28:43 [Peds Ansichten]
Was soll schon schiefgehen...
Kritik innerhalb des Narrativs der Herrschenden kann auch zum Eigentor werden. Die folgende kritische Analyse zeigt erneut auf ein Problem, dem sich Experten, gemeint sind auf ein bestimmtes Fach ausgerichtete Spezialisten immer wieder gegenüber stehen. Auf der täglich bearbeiteten Plattform absolut sattelfest, kommen sie ins Schlingern, wenn sie gläubig von außerhalb eingebrachte Annahmen als erwiesene, unbestreitbare Wahrheiten voraussetzen und dann zur Grundlage ihrer Arbeiten machen. Das grundlegende Problem ist, Günter Eder arbeitet mit Statistiken, die man so gar nicht mehr erheben dürfte, prinzipiell und die außerdem auch noch deutliche Merkmale von Statistikfälschung aufweisen.
06.09.2021 11:35:04 [Liberale Warte]
Der Kollektivismus: Die chronische Krankheit reifer Demokratien
Auf den Verdacht einer chronischen Erkrankung kann man sehr unterschiedlich reagieren. Da gibt es diejenigen, die ihre Symptome ignorieren, bis die bittere Wahrheit sie einholt. Andere sind sich ihrer Beschwerden bewusst. Doch sie wollen es gar nicht genau wissen. Ihr Unwohlsein schieben sie mal auf einen Bagatellinfekt, mal aufs Wetter und mal auf eine verdorbene Mahlzeit. Und dann sind da jene, die tief im Innersten um ihre Situation wissen, sich aber nicht trauen, den Dingen auf den Grund zu gehen, weil sie Angst vor der bestätigenden Diagnose haben.
06.09.2021 11:36:41 [Neuland Rebellen]
Sind wir nicht alle ein bisschen ungeimpft?
Am letzten Wochenende zogen sie die Schlinge wieder enger, verpesteten sie die ohnehin miese Stimmung abermals. Die Grünen in Baden-Württemberg machten schon mal klar, dass es einen Lockdown für Ungeimpfte geben könnte. Die müssten dann auf Kontakte verzichten und dürften kaum jemanden treffen. Solche Maßnahmen sind natürlich nur mit einer ausreichenden, für alle gut sichtbaren Kennzeichnung von ungeimpften Menschen kontrollierbar. Womöglich haben die grünen Khmer aber auch daran schon gedacht. Als Enkel jener Neuen Linken, die Habermas einst als »rote SA« titulierte, darf man nicht glauben, sie hätten nicht auch dafür schon einen netten Vorschlag in der Ledermanteltasche.
06.09.2021 13:23:31 [Dushan Wegner]
Versuchskaninchen im Sumpf
Wir waten durch einen Sumpf aus halben Wahrheiten und ganzen Lügen. Wer bitte glaubt denen noch irgendwas? Es ist geradezu erfrischend, wenn ein Politiker sich ehrlich macht und offen sagt: Ihr seid alle Versuchskaninchen! In der Krise könnte Demokratie nur dann als solche funktionieren und unbeschadet überleben, wenn das Volk in seelischen Angelegenheiten gebildet ist, auch in großen Entscheidungen bedächtig abwägt und seine Kreise gut zu ordnen weiß – ein Volk weiser Männer und Frauen.

Jedoch, es gibt kein Leben im Konjunktiv – dies ist eine Zeit mehrerer einander überlagernder Krisen.

06.09.2021 17:29:01 [Ansage!]
Es ist etwas aus dem Ruder gelaufen
Folgt man den Corona-Bedenkenträgern, könnte man meinen, durch die Straßen Deutschlands zögen marodierende Horden von Impfgegnern, welche Arztpraxen und Impfzentren in die Luft jagen und harmlose Passanten mit Schwaden von Viren einnebeln. Richtig üble Gesellen, Coroniban mit unstillbarem Blutdurst. Dürfen wir Katastrophen-Karl glauben, so entscheidet sich die nächste Bundestagswahl zwischen Olaf Scholz und Annalena Baerbock – denn Armin Laschet schwebt derzeit in Lebensgefahr (auch wenn Armin Laschet noch nichts davon weiß): Er hatte nämlich mit einem mutmaßlichen Querdenker von Angesicht zu Angesicht diskutiert – und keiner der beiden trug Maske!
06.09.2021 18:42:43 [Antikrieg]
Pandemie des Autoritarismus ist die wahre Bedrohung
Der Richter James Shapiro aus Cook County, Illinois, hat einen neuen Tiefpunkt der Covid-Tyrannei erreicht, indem er Rebecca Firlit verbot, ihren 11-jährigen Sohn zu sehen, solange sie nicht gegen Covid geimpft ist. Richter Shapiro ist nicht der Einzige, der die richterliche Macht missbraucht, um Menschen zur Impfung zu zwingen. Richter im ganzen Land haben Angeklagte zu Covid-Impfungen gezwungen, manchmal als Bedingung, um eine Gefängnisstrafe zu vermeiden. Dieser Ausbruch richterlicher Tyrannei ist ein Symptom für die Pandemie des Autoritarismus, die die wahre Bedrohung für Amerika darstellt.
07.09.2021 09:25:19 [Polit Platsch Quatsch]
Wahlversprechen: Mut zum Müssen
Sie liegen gut im Rennen, die sechs großen deutschen Parteien drei Wochen vor der Bundestagswahl, die wie immer wieder ein Schicksalswahl sein wird. Allen sechs etablierten Kräften dürfte der Sprung ins neue, mit knapp 1.000 Parlamentariern diesmal noch großartigere Parlament erneut gelingen - allenfalls die Linkspartei, seit Jahren auf dem Weg nach unten, könnte womöglich ein wenig zittern müssen. Als ahnten die Genossen das, ist die pflichtanzeigende Vokabel das Wort, das im Wahlprogramm der mehrfach umbenannten SED am häufigsten vorkommt.
07.09.2021 13:32:49 [Fliegende Bretter]
O tempora Corona!
Während der letzten gut eineinhalb Jahre habe ich ja so einiges Interessante über mich gelernt. Dass ich ein unkritisches, mucksch gemachtes Opfer eines faschistischen Systems bin zum Beispiel. Die Hosen voll habe. Mich von irrationalen Ängsten ins Bockshorn jagen lasse, die eine skrupellose Regierung mithilfe gekaufter Wissenschaftler, gleichgeschalteter Medien und anderer professioneller Panikmacher mir erfolgreich einredet. So zerfressen bin ich vor lauter Todesangst vor einer harmlosen Grippe, dass ich seit nunmehr eineinhalb Jahren artig Maske trage, wo man es mir befiehlt, mich an absurde Vorschriften halte und mir sogar einen tödlichen Impfstoff habe verabreichen lassen, der mich ganzbald schon in ein frühes Grab bringen wird.


07.09.2021 17:01:19 [Ansage!]
Robert Habeck: „Der Staat, das sind wir alle“
Der Co-Parteivorsitzende der Grünen, Robert Habeck, hat der Wochenzeitung „Die Zeit“ ein Interview gegeben, das insofern für Erleichterung sorgt, als daß klar geworden ist, wie wenig gewonnen gewesen wäre, wenn die Grünen ihn statt Annalena Baerbock zum Kanzlerkandidaten gekürt hätten. Die Medienkritik.

Unter der Schlagzeile „Der Staat, das sind wir alle“ ist bei der „Zeit“ in der Rubrik „Robert Habeck“ der folgende Teaser zu lesen: „Steuerhinterziehung ist keine Kleinigkeit, sagt Grünen-Co-Chef Robert Habeck. Im Interview verteidigt er die Meldeplattform für Steuerbetrug und spricht über Rot-Grün.“ – Da schnappt der Leser erst einmal nach Luft.

07.09.2021 17:07:36 [Apolut]
Ein streng gehütetes Covid-Geheimnis
Von Anfang an haben die Bundesregierung, das Gesundheitsministerium, das Robert Koch Institut und alle angeschlossenen Behörden nur auf eine einzige Karte, nämlich auf die abenteuerlich schnelle Entwicklung von Impfstoffen gesetzt, um die neue Covid-19 Krankheit zu bekämpfen, die von einem Virus der Corona-Familie verursacht wurde. Von einer Milliarde Euro Forschungszuschüssen des Staates zur Corona-Bekämpfung wurden 950 Millionen einigen wenigen Impfstoffentwicklern zugeschustert. Dabei wurde grob fahrlässig (böse Zungen behaupten mit Absicht) die Entwicklung neuer oder die Testung existierender Medikamente zur Prävention oder zur Bekämpfung der Krankheit vollkommen vernachlässigt.
08.09.2021 06:48:41 [QPress]
Politische Botschaft des Tages: „Grundrechtsabbau”
Die bedeutendste Botschaft des Tages dürfte sein, dass weiter intensiv an der Aushebelung der Grundrechte gearbeitet wird. Selbstverständlich wurde es viel liebevoller verpackt, nämlich als “goldener Akt” für den Wiederaufbau von der Flut zerstörter Gebiete. Die weitere Demontage der Grundrechte offen und ehrlich zu kommunizieren, konnte so erfolgreich vermieden werden. Wer für die materielle Fluthilfe stimmt, wird sicher bei dem bedeutend weniger wichtigen Thema “Grundrechte”, da immateriell, seine Zustimmung schon nicht versagen.
08.09.2021 06:50:11 [Gift am Himmel]
Alleister Crowley begegnet Clive Barker und Candyman
Die gesamte Lizenzvergabe von Candyman ist die Schöpfung von Clive Barker, der im Jahr 1985 eine Kurzgeschichte mit dem Titel The Forbidden geschrieben hat. Der erste Candyman Film, der auf The Forbidden beruht, erschien 1992. Barker hegte eine morbide Faszination für schwarze Magie und Magier, insbesondere für Alleister Crowley. Tatsächlich versuchte er sich selbst am Okkulten. Crowley, der gemeinhin als „der böseste Mann auf Erden“ bezeichnet wird, war ein Schwarzmagier, Kabbalist und Freimaurer. Während eines bestimmten Rituals kreuzigte Crowley tatsächlich einen Frosch als eine Form der Blasphemie.
08.09.2021 06:54:39 [Apolut]
Wie viele Impftote wollt Ihr noch?
Die schweren Nebenwirkungen der genmanipulativen Eingriffe durch sogenannte Corona-Impfungen sind längst bekannt und fordern nun auch immer mehr Tote.

Covid-Gen-Impfungen schützen nicht vor Corona. Neue Daten aus Israel deuten daraufhin, dass die Genspritzen sogar zu einer Covid-Erkrankung führen und zukünftige Corona-Infektionen begünstigen. Zusätzlich leiden und sterben viele Patienten an einer Vielzahl verschiedener direkter Nebenwirkungen der Behandlung. Staatliche Institutionen in den USA kannten diese Nebenwirkungen im vollen Umfang bereits im Jahr 2020 vor Beginn der Gen-Impfungen.

08.09.2021 07:03:54 [Neuland Rebellen]
Der wirksamste Feind, den es für die Demokratie je gab
Es ist alles andere als neu, dass die Mächtigen von Gesellschaften auf Feindbilder angewiesen sind. Wer den Fokus auf einen Feind richten kann, lehnt sich entspannt zurück und beobachtet, wie die „Meute“ auf ihn losgeht. Doch kein Feind war je so gut wie ein Virus.

Das Wesen der Demokratie ist (wäre) eine Gesellschaft ohne Angst. Nicht ohne persönliche Angst, die lässt sich nicht spurlos entfernen, da es sich um eine Angst handelt, die individuell ist und unser Herz berührt. Auch Phobien lassen sich nicht politisch behandeln, da müssen andere Fachleute ran.

08.09.2021 07:13:34 [Vera Lengsfeld]
Der verlogene Wirbel um Till Schweiger
Kinder und Jugendliche sind die Hauptopfer der rabiaten, unkontrollierten Corona-Politik. Anderthalb Jahre mussten sie auf das verzichten, was für Heranwachsende das Wichtigste ist: normale menschliche Kontakte. Zu Beginn der Krise waren sogar die Spielplätze an der frischen Luft gesperrt, Kinder sollten nur noch einen Freund sehen dürfen. Kindergärten und Schulen wurden willkürlich geschlossen. Politiker wie Markus Söder und Kanzlerin Merkel redeten Kindern medienwirksam ein, dass sie sich am Tod ihrer Großeltern schuldig machen könnten, wenn sie sich nicht an die verordnete Isolation hielten.
08.09.2021 09:16:13 [Polit Platsch Quatsch]
Wer, wenn nicht jetzt: Das Zauberwort der Zauderer
Luftbrücke Jetzt. Mietbremse Jetzt. Klimaschutz Jetzt. Bus und Bahn kostenlos - jetzt! Und Das alles jetzt erst recht, denn es ist Wahlkampf und der Augenblick entscheidet. Wann also, wenn nicht jetzt? Laschet punkte jetzt als "Teamplayer" (Tagesschau), Olaf Scholz sorgt jetzt dafür, dass die Digitalisierung klappt. Saskia Esken, eine spröde Büroklammer der Politik, ist jetzt zu allem bereit, so es denn nur den ersehnten Ministerposten bringt. Friedrich Merz, ein Mann von Vorgestern, ist jetzt im "Zukunftsteam" (Bild). Und die FDP hat sich jetzt noch nicht entschieden, ob sie die Republik wirklich vor Rot-Rot-Grün retten wird.
08.09.2021 13:51:03 [Apolut]
Great Reset – die Elite setzt auf die Grünen
Wir erleben zurzeit eine der größten Umwälzungen in der Geschichte der Menschheit. Das Wirtschafts- und Finanzsystem, das eine winzige Minderheit in die Lage versetzt hat, die Mehrheit der Menschen über Jahrhunderte zu beherrschen, ist zerbrochen und lässt sich mit den bisherigen Methoden nicht länger am Leben erhalten.

Um dennoch die Kontrolle über die Gesellschaft zu behalten, hat die Minderheit offensichtlich beschlossen, das bestehende System durch ein neues zu ersetzen. Wie das geschehen soll, hat einer ihrer wichtigsten Vertreter, Klaus Schwab, der Direktor des World Economic Forum (WEF), in seinem Buch „The Great Reset“ beschrieben: Nicht durch allmähliche Transformation, sondern durch kreative Zerstörung.

08.09.2021 15:07:56 [Elynitthria]
Pancho Villa reitet wieder
Im übertragenen Sinne.

Die Taliban haben ihre neue Regierung vorgeschlagen.

Sie ist der erhobene Mittelfinger zum erhobenen Zeigefinger der westlichen Retter der Menschheit!

Alleine der Innenminister ist ein Mann, auf den die USA 5 Millionen Dollar Kopfgeld ausgesetzt haben.

Der von den Democrats gegen seinen Willen als Homosexueller geoutete Senator Lindsey Graham – plötzlich fällt einem auf, dass er einen überwiegend für Frauen genutzten Vornamen hat – brüllt schon rum, dass man wider einmarschieren soll.

Die Grundidee des Islam ist basisbanal.

Die Menschheit ist von Gott abgefallen und es ist die Aufgabe der Moslems, sie zu Gott zurück zu führen. Wie das geht, beschreibt der Koran.

08.09.2021 15:22:38 [Ansage!]
Totalitäre Tendenzen in unserer Gesellschaft
Ich hätte nie gedacht, dass ich dies – gerade auch als Deutscher – einmal feststellen müsste, aber es gab in den letzten Jahren fast keine politische Entwicklung, die keine potentiell totalitären Grundzüge aufwies. Was zunächst wie eine der sogenannten „Verschwörungstheorien“ klingen mag, ist leider bittere Realität. Man kann jedes beliebige Lexikon zur Hand nehmen oder auch Google bemühen, und muss dort nur einmal den Begriff „Totalitarismus“ nachschlagen: Überall wird man weitgehend identische, definierte Merkmale finden, anhand derer totalitäre Mechanismen zu identifizieren sind.


08.09.2021 15:24:59 [Apolut]
Gesundheit in der Hand des Staates
In einem globalen Staatsstreich, angetrieben von einem übermächtigen Kartell aus Big Pharma, Big Tech und Big Media, ausgeführt von fragwürdigen Politikern mit noch fragwürdigerem Beraterstab, zog vor gut 18 Monaten quasi über Nacht eine Pandemie in (fast) allen Herren Ländern ein.

Alternativlos gelten seitdem Maskenpflicht, Lockdown und alle anderen drakonischen Maßnahmen. Bloß keine Fragen stellen und keine Zweifel hegen. Eine Diskussion über die Sinnhaftigkeit oder die bloße Kenntnisnahme der Schäden und Langzeitauswirkungen vieler Maßnahmen trotz erdrückender Faktenlage wird rigoros abgelehnt oder negiert.

08.09.2021 18:48:00 [Dushan Wegner]
Ob sie dir vergeben werden?
Wer eine verbotene Wahrheit ausspricht, der gilt als böse. Werden die Schmierigen dir, wenn du dich deren Lügen unterwirfst, wieder vergeben? Ach, mach dir nichts vor. Die wichtigere Frage ist ja auch: Wirst du selbst dir dereinst vergeben können?

Es ist erschütternd – und das sage ich ohne Übertreibung – ich empfinde es als ehrlich erschütternd, was für schmierige Gestalten dem Volk heute von Presse, Politik und Propaganda als moralische Autoritäten präsentiert werden. Wer jedoch eine verbotene Wahrheit ausspricht, oder wer eine Frage stellt, deren Antwort aus einer verbotenen Wahrheit bestehen könnte, so einer gilt den Schmierigen als Feind.

09.09.2021 09:13:36 [Polit Platsch Quatsch]
Merkels Bilanz: Ein wirklich smarter Staat
Er hat seine Corona-Maßnahmen nie so richtig vermitteln können, den Energieausstieg wacker behauptet, aber ebenso wie die Kohlendioxidsenkung nicht realisieren können. Die Elektrifizierung der Bahn ist in 70 Jahren nicht vollendet worden, die Begrenzung der Größe des Bundestages blieb ein Symbol, das ihn demnächst noch größer werden lassen wird. Aber an der Heimatfront, dort, wo der vormundschaftliche Staat sich die Kraft holt, die Gewogenheit der Bürger zu erringen, zeigte die oft kritisierte Versteinerung der Verhältnisse durch Bürokratisierung und allgegenwärtige Prozesshanselei, zu welch enormen Leistungen sie fähig ist: Der bundesdeutsche Staat ist heute, nach 16 Jahren Angela Merkel, zwei Finanzkrisen und einer Pandemie, finanziell besser ausgestattet als je zuvor.
09.09.2021 10:58:25 [Meine Meinung Meine Seite]
Man könnte von Erpressung sprechen
Zwischen der EU- Kommission und den EU- Staaten Polen und Ungarn – beide gehören übrigens zu den Visegrad- Staaten – schwelt schon lange ein offener Streit. Die EU- Kommission sieht in diesen zwei Staaten die Rechtsstaatlichkeit in Gefahr und macht zunehmend Druck, besonders mit Drohungen finanzieller Natur und mit Vertragsverletzungsverfahren. „Die Rechtsstaatlichkeit ist ein Grundwert der EU und fundamental für das Funktionieren der EU“. Und da gebe es mittlerweile ernsthafte Probleme mit Ungarn und Polen. Daher sei es „höchste Zeit für Druck“ auf diese beiden Staaten, meinte z. B. ein für Carnegie Europe tätiger Österreicher.
09.09.2021 11:19:17 [Ansage!]
Volksvertreter vertreten das Volk, wenn es mal nicht da ist
Es ist doch ganz einfach: Jeder Mensch möchte nicht fast ausschließlich für die Miete arbeiten, weshalb sich jene Menschen freuen, die Hausbesitzer, Großverdiener oder sonstige Kinder des finanziellen Glücks sind. Jeder möchte nicht nur für seinen Job gut bezahlt, sondern auch nicht wie ein Mastochse besteuert werden – wo doch der Bund der Steuerzahler jüngst vorrechnete, dass wir erst jenseits der Jahreshälfte (pauschal gesehen) nicht mehr für den Staat, sondern ausnahmsweise mal für uns selbst arbeiten.

Nehmen wir dann mal den armen Handwerker, der nach mehr als 30 Jahren schwerster Maloche zum Jobcenter muß, weil sein kaputtes Kreuz für keinen Handwerksbetrieb mehr tauglich ist.

09.09.2021 13:15:55 [ScienceFiles]
Der Impf-Pate von Dresden
Nach der Unterwerfung fordert die Impf-Mafia einen Zusatzdeal; Vergleichbar einer Art Versicherung gegen zufällig ausbrechende Brände im Restaurant, die von der Versicherung gegen zufällige auftauchende Schlägerbanden nicht umfasst ist. Der Zusatzdeal sieht vor, dass Tests durch einen weitereichenden Schutz per Impf-Unterwerfung ersetzt werden und dann nicht mehr durchgeführt werden müssen, vorläufig nicht mehr, bis auf Weiteres nicht mehr, eine Art zeitlich befristeter Ablasshandel.

Wer dazu nicht bereit ist, der muss weiter testen und dafür zusätzlich bezahlen, ein Schutzgeld um ein Unterwerfungsritual durchführen zu dürfen, das ihm einen Teil der geraubten Freiheiten zurückgibt, für sehr kurze Zeit.

09.09.2021 15:18:29 [Neuland Rebellen]
Die Pandemie, die niemals endet...
…es sei denn, wir beenden sie. Es wird Zeit, der Wahrheit ins Auge zu blicken. Insbesondere für die, die sich bisher standhaft an die Erzählungen von Politik und Medien geklammert haben.

Es ist nicht mehr die Zeit des Argumentierens. Nicht mit dem PCR-Test. Nicht mit den Risikogruppen oder den Todesfallzahlen. Auch nicht mit der Inzidenz oder der Frage, ob „an“ oder „mit“ Corona gestorben. Keinesfalls kann man mit der Belegung der Intensivbetten argumentieren, die faktisch niemals an ihre Grenzen stießen. Die Wirkung der Masken kann man ebenso auslassen wie das Argumentieren mit Impfstoffen, die in Windeseile auf den Markt gebracht wurden.

09.09.2021 16:53:09 [Apolut]
Erneute Änderung des Infektionsschutzgesetzes
Die politische Strategie einer auffällig-aggressiv verhinderten, breiten Gesellschafts-Diskussion im Verlauf dieser sogenannten Corona-Krise zeigt nun die anvisierte Wirkung. Der nachhaltig erzwungene Nicht-Diskurs erwirkt mittlerweile die erwünschte Reaktion bei einem Großteil der Menschen in diesem Land. Durch die permanent einseitige Manipulation und Dauerberieselung hinsichtlich der kommunizierten Einschätzungen zur Corona-Thematik und den dazu parallel laufenden Maßnahmen, zeigt sich bei sehr vielen Bürgern das Phänomen der schlichten Informations-Ermüdung.


09.09.2021 16:55:30 [Die Ostschweiz]
Jagd ist eröffnet
Der Hass auf die Gesunden begann schon vor einem Jahr. Die Wut der maskentragenden Mehrheit auf die Minderheit jener, die maskenfrei und gesund bleiben wollten, nahm erschreckende Ausmasse an. Man wurde beschimpft, denunziert, bedroht. An der Maskenfrage zerbrachen ganze Freundschaften und Familien, eine ganze Nation.

Aber das war nur der Anfang. Am Wochenende las ich zwei Presseschlagzeilen, die wie rohe Gewalt auf mich wirkten. «Die Arroganz der Ungeimpften» hiess die Headline am Samstag. Und die andere, wie abgekartet, einen Tag später: «Jetzt muss Berset Impfgegner endlich zur Impfung zwingen».

09.09.2021 19:05:02 [Unbesorgt]
Teutonen, Tesla, Taliban
Um es gleich vorweg zu sagen: ich hätte mir gewünscht, die Amerikaner hätten ihre Minimalpräsenz von etwa 2.000 Soldaten in Afghanistan beibehalten, weil selbst solch ein Schwebezustand allemal besser wäre als das, was uns nun bevorsteht. Zur Kostenkompensation hätte sich der Truppenabzug aus Deutschland angeboten, auch wenn ich mir nicht mehr ganz sicher bin, ob wir wirklich schon auf uns selbst aufpassen können. Doch will ich hier kein Wort über den völlig aus dem Ruder gelaufenen Truppenabzug verlieren, sondern zu Beginn nur kurz meine vergeblichen Versuche skizzieren, der kopflosen Flucht etwa planvolles, jedoch verborgenes abzugewinnen.
10.09.2021 09:35:56 [Polit Platsch Quatsch]
Annalena Baerbock: Im Fadenkreuz der Faktenchecker
Natürlich liebt sie Hunde. Natürlich ist ihr der Gedanke ein Schrecken, dass die Menschheit sich eines Tages wird entscheiden müssen zwischen Haustierhaltung zum Vergnügen und Klimaüberleben. Natürlich weiß Annalena Baerbock genau, dass dieser Tag noch nicht gekommen ist: Wie der deutsche Wohlstandsmensch seinen Wohnwagenurlaub liebt, seine mit Rohdieselschiffen über weite Strecken angelieferten elektronischen Spielzeuge und den Kaffee aus Übersee, der eine fast ebenso lange Reise auf genauso schmutzigen Schiffen hinter sich hat, so liebt er auch seinen Hund, seine Katze, das Meerschwein und den Sittich.
10.09.2021 11:24:50 [Zettels Raum]
Neues von der Impfung: Das Narrativ muss stimmen!
Der eine oder andere mag es schon in den letzten Tagen gelesen haben: In einem Seniorenheim in Oberhausen kam es im Rahmen einer Aktion zum Thema "Booster-Impfung" zu einer Reihe von Impfkomplikationen. Kurz gesagt, von den 90 "nachgeimpften" Senioren hatten 9 schwere Impfkomplikationen, Zwei musten reanimiert werden und zunächst wurde fälschlicherweise auch berichtet es habe einen Toten gegeben.

Jetzt wäre das prinzipiell noch kein Beinbruch. Die Stichprobe ist für statistische Verhältnisse nicht nur klein, sie ist so klein, dass man fast keine Aussage daraus ableiten kann.

10.09.2021 11:26:25 [Polit Platsch Quatsch]
Hungerstreik: Wenn der kleine Hunger kommt
Einer musste schon aussteigen aus dem "Hungerstreik der letzten Generation", der bis zum bitteren Ende durchgeführt werden wird. Klima oder Tod! Oder eben doch ein "Gespräch mit den drei Kanzlerinnenkandidatinnen", zwei Stunden wenigstens und das öffentlich, wenn schon denn schon. So haben es sich die sieben sechs jungen Menschen gedacht, die seit Ende August in Berlin hungern und bei Twitter trommeln.

Eine Verzweiflungstat einer Generation, die in Elternhaus, Schule und Ausbildung den Eindruck vermittelt bekommen hat, dass sich alles um sie dreht und alles nach ihrem Kopf geht.

10.09.2021 13:10:53 [Tichys Einblick]
Merkels Zufriedenheit
Am Mittwochabend saß eine gut gelaunte und mit sich zufriedene Angela Merkel auf der Bühne des Schauspielhauses in Düsseldorf neben der nigerianischen Schriftstellerin Chimamanda Ngozi Adichie – deren Bücher sie, wahrscheinlich, ohne sie gelesen zu haben, als hilfreich empfindet –, der Publizistin Miriam Meckel und der Journalistin Léa Steinacker. Merkel spricht darüber, dass sie „als Kind mit geistig Behinderten zusammen aufgewachsen“ ist und daher „keine Furcht und Berührungsängste hatte.“ Gern hätte man an dieser Stelle von ihr erfahren, zu wem sie außerdem keine Berührungsängste hatte. Sie spricht über den Tod der Mutter, wie sieht es aber mit den politischen Ansichten des Vaters aus?
10.09.2021 17:05:06 [Gift am Himmel]
20 Jahre regierungsfinanzierte Tyrannei
Der Aufstieg des sicherheits-industriellen Komplexes yon 9/11 bis zu COVID-19. Welch seltsamen und steinigen Weg wir seit dem 11. September 2001 zurückgelegt haben, übersät mit den Trümmern unserer einst gepriesenen Freiheiten. Wir haben uns von einer Nation, die ausgesprochen stolz darauf war, als Modell für die repräsentative Demokratie zu dienen, zu einem Modell entwickelt, ein freiheitsliebendes Volk dazu zu bringen mit einem Polizeistaat im Gleichschritt zu marschieren. Was mit der Verabschiedung des USA Patriot Act nach dem 11. September 2001 begann, hat sich zu einem Schneeballsystem entwickelt, das jeden wichtigen Schutz vor staatlicher Übervorteilung, Korruption und Mißbrauch aushebelt.
11.09.2021 07:19:17 [Apolut]
Illegale Geheimverträge des Impfherstellers Pfizer mit Nationalstaaten
Ende letzten Jahres sagte RKI-Chef Lothar Wieler schier unglaubliches in einem TV-Interview: „Also, wir gehen alle davon aus, dass im nächsten Jahr Impfstoffe zugelassen werden. Wir wissen nicht genau, wie die wirken. Wie gut die wirken. Was die bewirken. Aber ich bin sehr optimistisch, dass es Impfstoffe gibt.“ Wir werden also mit massivem Erpressungsdruck dazu gebracht, uns eine Substanz einzuverleiben, über deren Wirkungsweise und Schadenspotential bis jetzt nichts bekannt ist. Das ist vom medizinischen und ethischen Gesichtspunkt aus eine komplett verantwortungslose Haltung, die der RKI-Chef hier einnimmt.
11.09.2021 09:32:25 [Polit Platsch Quatsch]
20 Jahre Terror: Abschied der Weltmacht
20 Jahre später ist die Geschichte schnell erzählt. Osama bin Laden kam damals mit dem Flugzeug, er flog erst in den einen Turm, dann in den anderen, wenig später schon brach alles zusammen. Der Präsident stieg in die Air Force One, weil das in jedem Film so gemacht wird. In Palästina feierten sie, aber nur einen Moment lang, dann wurden die Kameras rücksichtvoll abgeschaltet. 3.000 Menschen waren tot, einige von ihnen hatten in Hamburg studiert, doch die deutschen Geheimdienste wussten nicht mehr über sie zu sagen als später über die Taten des Nationalsozialistischen Untergrunds, die Überwachung des Handys der Bundeskanzlerin oder die Tatvorbereitungen des Breitscheidplatz-Attentäters Anis Amri.
11.09.2021 14:03:30 [Polit Platsch Quatsch]
Thüringen: 100 Jahre unregierbar
Ungeimpft und unregierbar: Die Thüringer, ein zum Glück nur zwei Millionen kleines Bergvolk im äußersten Süden des abgelegenen Ostens der Republik, feiern heute ein ungewöhnliches Jubiläum: Am 11. September vor 100 Jahren wählte das erst am 1. Mai 1920 gegründete Land bereits zum zweiten Mal ein Parlament, das die erste Koalition aus SPD und DDP sich nur mit Hilfe der USPD an der macht hatte halten können. Man einigte sich zwar auf ein stolzes Landeswappen, sieben silberne Sterne auf rotem Grund, die für die sieben Einzelstaaten, aus denen Thüringen gebildet worden war. Viel mehr aber ging nicht und so ging es zurück zur Urne.
11.09.2021 14:22:29 [Reitschuster]
Diese Wahl ist für Demokraten verloren
Hundeerziehung folgt einem einfachen Prinzip. Man zwingt das Tier zu verinnerlichen: Dein Futter erhältst Du gegen blinden Gehorsam. Der Hund lernt, er hat nur dann, nur dort und nur so viel zu fressen, wie es sein Erzieher festlegt. Gründe haben ihn nicht zu interessieren. Diese Macht über das Futter ist das Gewaltmonopol des Hundebesitzers. Alle weitere Erziehung leitet sich von ihr ab.

Von China über Australien bis nach Frankreich sehen sich auch die Regenten als Erzieher. Und die Politiker aller großen Parteien bilden sich ein, ihre Untertanen disziplinieren zu müssen, um ein “Funktionieren” in einer immer größer werdenden Weltbevölkerung sicherzustellen.

11.09.2021 16:01:56 [Novo Argumente]
Es gibt keine moderaten Taliban
20 Jahre nach den Terroranschlägen vom 11. September 2001 fallen zu viele im Westen auf den Mythos einer reformierten, geläuterten Taliban herein.

Hätte Ihnen jemand im September 2001, als die Zwillingstürme fielen und die Menschen im Pentagon starben, gesagt, dass Amerika es am 20. Jahrestag dieser Gräueltat in Erwägung zöge, sich mit den Helfershelfern dieser Tat zu verbünden, hätten Sie ihn für verrückt erklärt. Doch nun sind 20 Jahre seit diesem düsteren, apokalyptischen Tag vergangen, und ein US-Militärchef hält es für „möglich“, dass seine Streitkräfte mit den Taliban zusammenarbeiten werden.

11.09.2021 17:25:07 [Telepolis]
Das Ende der Zukunft
Das neue Buch von Mathias Bröckers, Corona und der 11. September und 11 Thesen. Kommentar: Der Fernseher ging an und trug uns hinaus aus unserer Gegenwart auf eine Reise ohne Wiederkehr, hinein in die abenteuerlichsten Winkel unserer an historischen Sachbüchern und Science-Fiction-Filmen geschulten Phantasie.

Ein Telefonat und unklare Botschaften aus dem seinerzeit noch langsamen, per externem Modem betriebenen "World Wide Web" waren vorausgegangen. "In New York ist gerade das World Trade Center eingestürzt", sagte die Telepolis-Redakteurin. Ich glaubte, sie meinte einen neuen Börsenkrach. Das war man gewohnt, zuletzt 1997. Was man dann sah, war nicht gewohnt.

Es war überraschend, neu, ungesehen, erschütternd.

11.09.2021 18:35:46 [Meine Meinung Meine Seite]
Bissiges zu Wahlwerbung und Politik
In Oberösterreich, in Graz – und auch in Deutschland wird in Kürze und am selben Tag gewählt und man wird, da der Wahlkampf in die heiße Phase übergeht, mit Wahlwerbung zugeschüttet. Im Fernsehen, in den Printmedien, auf Großplakaten und Plakatständern – es gibt kein Entkommen vor dieser Partei- und Wahlwerbung. Das ist keine Information mehr, das ist schon Belästigung. Und dann, als Höhepunkt der nervtötenden Wahlkampagnen, die personalisierte Stimmenschnorrerei, die der Briefträger ins Haus bringt. Ihr (gar nicht) lieben Parteien und Spitzenkandidaten! Hört doch auf, die Leute zu nerven. Da werden nur Unsummen an Steuergeld verbraten, für großteils nichtssagende Floskeln.

Dabei geht es auch anders. Man kann wahlwerbende Politiker mit wahren Sprüchen konfrontieren und mit Zitaten von Politikern.

12.09.2021 07:32:09 [Dushan Wegner]
Garstiges Gift vom geschmeidigen Gauck
»Bekloppte«, so nennt der geschmeidige Gauck alle Impfgegner. Es ist wieder einmal üble, spaltende Hetze – und jeder sollte das ablehnen, egal wie man zur Impfung steht. Sie erinnern sich bestimmt noch an Gauck. Das ist der Herr, der sagte: »Die Eliten sind gar nicht das Problem, die Bevölkerungen sind im Moment das Problem«. Herr Gauck will der Bevölkerung, also dem »Problem«, nun mitteilen, dass wir in »Bildungswillige« und in »Bekloppte« aufzuteilen sei. Zitat: "Dann ist ja auch schrecklich, dass wir in einem Land leben, in dem nicht nur Bildungswillige leben, sondern auch hinreichende Zahlen von Bekloppten".
12.09.2021 09:40:46 [Heise]
Vom Schultern der Särge und anderen Anstrengungen nach 9/11
Die Wochenschau von Hal Faber: Auch die Debatte um Freiheit, Privatsphäre und Sicherheit wird weitergeführt. Wenn diese Übersicht von Netzpolitik stimmt, dann wurden in Deutschland in den letzten 20 Jahren mehr als 50 Gesetze eingeführt, verändert und verabschiedet, die die Überwachung ausgebaut haben. Dazu muss man die stetig wachsenden Budgets für die Sicherheitsapparate rechnen, die neuen wie etwa ZITis wie die alten Rösser Verfassungsschutz oder BND, der "seit Snowdens Enthüllungen" seinen Etat verdreifachen konnte.
12.09.2021 09:44:29 [Polit Platsch Quatsch]
Faktencheck: Baerbocks Traum vom grünen Zement
Deutschland, zumindest soweit es seine Spitzenpolitik betrifft, ist schon ein gutes Stück vorangekommen auf dem Weg, sich von den engen Fesseln der Ökonomie zu befreien. Dass klimaneutraler Stahl und klimaneutraler Zement theoretisch möglich, aber praktisch teuer sind, bremst nur die Fantasie unbelehrbarer Skeptiker. Annalena Baerbock und ihr - inzwischen nur noch als "Co-Vorsitzender" bezeichneter - Vorsitzendenkollege Robert Habeck dagegen "waren nicht nur in den letzten Wochen, sondern in den letzten Jahren ja immer wieder vor Ort unterwegs" an den "Orten der Veränderung", wie es Baerbock unnachahmlich charmant formuliert hat.
12.09.2021 11:47:43 [Neuland Rebellen]
Ungeimpfte ausrotten
Eine Krankheit geht um. Sie hat Namen und Adressen, und sie versteckt sich nicht einmal. Zumindest noch nicht. Aber wir müssen der Krankheit auf die Spur kommen, müssen sie isolieren, bekämpfen und letztlich vernichten.

Wir alle mussten große Opfer bringen. Gesundheitliche. Wirtschaftliche. Kulturelle. Psychologische. Globale. Aber das war es wert, denn heute ist unsere Gesellschaft wieder gesund. Fast gesund. Und die ganze Welt beginnt durchzuatmen. Millionen sind an Hunger gestorben oder werden daran sterben. Aber für uns ging es um Leben und Tod.
Wir mussten Prioritäten setzen, wir haben Prioritäten gesetzt, und wir waren erfolgreich.

12.09.2021 11:50:35 [Tichys Einblick]
Im Wahl-O-Mat der Bundesregierung gewinnt die AfD triumphal
Da habe ich was angerichtet! Jetzt kommen die Mails aus dem ganzen Land im Minutentakt: „Ich bin eigentlich Stammwähler der SPD. Aber der Wahl-O-Mat macht mich zum AfD-Anhänger.“ Oder: „Wir haben die Wahl-O-Mat-Fragen im Freundeskreis beantwortet. Selbst drei grüne Familienväter und ein Türke landeten mehrheitlich bei der AfD. Was sollen wir denn jetzt wählen, Herr Hahne?“

Meine Antwort: diese Entscheidung kann ich Ihnen nicht abnehmen. Aber vertrauen Sie ruhig dem Wahl-O-Mat. Er ist nämlich sozusagen regierungsamtlich. Und wir vertrauen den Herrschenden doch auch zum Beispiel bei den regierungsamtlichen Klima- und Corona-Restriktionen.

12.09.2021 11:55:34 [Ansage!]
Diskriminierung Ungeimpfter schreitet voran
Es wird übel. Sehr übel. Die schlimmsten Befürchtungen werden aktuell im Stundentakt übertroffen: Mit dem Rückenwind des gerechten Volkszorns, ertüchtigt durch einen in diesem Land nicht zum ersten Mal pervertierten volonte general (aber eben nicht de tous) wagen sich immer mehr Unternehmen, Verantwortungsträger und Entscheider aus der Deckung, um ihren niedersten Instinkten zu frönen. Endlich ist wieder ein einheitliches Feindbild gefunden, das mit gutem Gewissen diskriminiert und erniedrigt werden darf – auf dass die eigene Untadeligkeit erstrahlen möge! Die Impfkampagne hat die Büchse der Pandora geöffnet und bringt endlich wieder das Hässlichste im Menschen zum Vorteil.
12.09.2021 13:40:25 [Antikrieg]
Die Biden-Administration verliert den Krieg gegen COVID
Am Donnerstag hielt unser neuer "Lieber Führer" Joe Biden eine der tyrannischsten Reden in der amerikanischen Geschichte. 30 Minuten lang verkündete er, dass die Bundesregierung eine totalitäre Maßnahme nach der anderen ergreifen werde, und setzte dabei unser Verfassungssystem völlig außer Kraft. Sicher, die Empörung ist in jeder Faser meines Wesens zu spüren. Ich schäme mich dafür, dass dieses Weiße Haus im Moment das Sagen hat.

12.09.2021 14:20:32 [M 7]
Morto un Papa se ne fa un altro!
Wenn die Zeit vorbei ist, ist es Zeit zu gehen. Eine, wie es scheint, einfache Wahrheit, die zu begreifen für viele Akteure allerdings nicht so einfach ist. Zu sehr sind sie mit Amt oder Mandat verschmolzen, zu sehr sind die Insignien der Macht zu einem Accessoire der eigenen Persönlichkeit geworden. Das Bild von der eigenen Person verschwimmt, nicht der eigene Charakter oder die eigenen Taten werden zur Messgröße der Selbstbegutachtung, sondern der Status. Und dieser definiert sich durch die Anzahl derer, denen man Anweisungen geben kann, durch die Geldsumme, über die man verfügen darf.
12.09.2021 15:37:12 [Ansage!]
„Alles läuft nach Plan“: Bald sind die 5- bis 11-jährigen dran
Unbeirrt läuft das Programm weiter, und längst entbehrt es jeder rationalen Nachvollziehbarkeit: Auch wenn die Wahrscheinlichkeit, eine Impfreaktion durchzumachen Impfnebenwirkungen zu erleiden, für Minderjährige weitaus höher ist als ein schwerer oder sogar überhaupt nur symptomatischer Covid-Verlauf, wird stur nicht nur an der Verspritzung hochexperimenteller Vakzine in der Altersstufe der 12- bis 17-jährigen festgehalten (wofür eigens die widerwillige Empfehlung der Stiko politisch erpresst wurde), sondern das Alter der solcherart „Beglückten“ soll immer weiter abgesenkt werden – auf dass die Zahl der „50 Millionen Versuchskaninchen“ (Olaf Scholz) weiter steige.
12.09.2021 15:42:11 [Apolut]
Der fortwährende Übergriff
Die Corona-Maßnahmen sind der größte gesundheitspolitische Fehler der Geschichte — trotzdem haben sich viele an die Beschneidung ihrer Rechte gewöhnt. Warum fühlen sich die meisten Menschen durch die staatliche Bevormundung nicht in ihrem Stolz gekränkt? Vielleicht, weil sie keinen haben. Die Art und Weise, wie Menschen das Corona-Geschehen wahrnehmen, ist grundverschieden. Kleinliche Regeln und Verbote machen die einen wütend, während sich die anderen dadurch geschützt fühlen. Der autoritäre Geist, der „oben“ wie „unten“ seit Beginn der Krise spürbar ist, wurde schon im Vorfeld trainiert. Da der Abschied von Freiheit und Selbstbestimmung in kleinen Schritten erfolgte, ging er den Menschen nach und nach in Fleisch und Blut über.
12.09.2021 17:13:52 [ScienceFiles]
Die Stadt der Zukunft, wie sie sich Grüne/Bündnis90 vorstellen
Nehmen wir es gleich vorweg, in der Grüne/Bündnis90-Vision der Stadt der Zukunft kommt Arbeit nicht vor. Arbeit ist etwas, das niedrige Lebensformen erbringen, während diejenigen, die Grüne/Bündnis90 für ihre Klientel halten, sich dadurch auszeichnen, dass sie, behindert sind, Kinder betreuen, in der Öffentlichkeit spielen und in einer Form Wohn-Kolchose, in der Privateigentum verschwunden ist, leben.

Die Grüne/Bündnis90 Version ist eine Neuauflage kommunistischer Phantasien, in denen nur Platz hat, wer einer Ausprägung des Modell-Menschen entspricht, den die Grünen/Bündnis90 als ihren neuen Arier entworfen haben.

12.09.2021 17:29:48 [Dushan Wegner]
Krieg gegen Ungeimpfte
Infizierter Geimpfter infiziert anderen Geimpften. Der trifft auf Ungeimpften. Dieser muss dann gesund in Quarantäne – und wird dafür brutal finanziell bestraft. Es ist Wahnsinn! Es ist ein Experiment, was Menschen alles hinnehmen, bevor sie zerbrechen. Aus dem angeblichen Kampf gegen Covid-19 wird ein offener Krieg gegen Ungeimpfte. Eines haben wir bereits gelernt, denn dies war die erste Lehre unserer erlebten Geschichte: Wir wissen und sehen heut, wie schnell Länder und Gesellschaften aus der Freiheit herausrutschen können, wenn Politik, Presse, Polizei und Propaganda als Rädchen einer einzigen großen, bösen Maschine ineinandergreifen.
12.09.2021 17:32:50 [Neuland Rebellen]
Nicht meine Welt
Woke Spinner. Pandemie 24/7. Gendergaga. Humorlosigkeit. Wichtigtuer an allen Ecken. Selbstgerechtigkeit. Wo sind denn die guten Jahre hin, wo noch nicht alle gut sein wollten? Hilfe, ich sitze hier fest, komme nicht mehr raus! So helft mir doch aus meiner Nostalgie!

Ich ertappe mich in letzter Zeit häufiger, wie ich irgendwelche alten Sachen bei YouTube gucke. Neulich erst so eine kurze Zusammenstellung irgendwelcher Erfolgshits aus den Achtzigern. Erst dachte ich mir: Geile Musik. Besser als heute. Dann kam ich zu der Einsicht, dass früher die Dinge überhaupt besser waren. Nicht immer und nicht grundsätzlich. Aber in unzähligen Einzelfällen schon.

12.09.2021 18:36:56 [Vera Lengsfeld]
Nur die allerdümmsten Kälber…
…wählen ihren Schlächter selber. Genau danach sieht es aus bei der diesjährigen Bundestagswahl. Die SPD scheint das Rennen zu machen und wird mit den Grünen eine Regierung bilden. Die FDP, die mit ins Boot geholt werden muss, wird alle Vorhaben von Rot-Grün durchwinken. Es sage hinterher Niemand, man hätte ja nicht ahnen können, was eine grün dominierte, denn darum wird es sich handeln, Regierung bedeutet. Sie sagen ganz offen, was sie wollen und halten es nur für nötig, den Leuten Sand in die Augen zu streuen, damit sie sich über die Folgen der großen Transformation, die vor unser aller Augen geplant und kräftig beworben wird, keine Gedanken machen.
12.09.2021 18:57:49 [Klaus Peter Krause]
„Das Virus Covid-19 gibt es nicht“
Diese Covid-19-Seuche ist eine hochgefährliche Pandemie nur deshalb, weil sie die Politiker und die politischen Führungen in allen Ländern der Erde erfasst hat – hochgefährlich für die Freiheit der Menschen. Die massiven staatlichen Eingriffe in die Grundrechte und die Freiheit ist echter Extremismus, nicht nur behaupteter. Von Anfang an hat es sich weniger um eine medizinische Herausforderung gehandelt, sondern mehr um eine politische Machtergreifung. Das medizinische Bemühen und die ärztliche Pflicht, des Coronavirus‘ Herr zu werden, wird politisch dazu missbraucht, des Volkes Herr zu werden.
13.09.2021 09:28:54 [Rationalgalerie]
Ich gestehe!
Bekenntnisse eines Verschwörungs-Theoretikers. Ich mache das schon seit Jahren: Ich behaupte, dass sich die Kapitalisten aller Art gegen die Normalos verschworen haben. Ich bin so ideologisiert, ich glaube doch glatt, dass die Rüstungs-Industrie an Kriegen interessiert ist, nur um Geld daran zu verdienen! Dass sie seit Jahren Konflikte zwischen Nationen unterstützt, nur um die Kriegsfurcht zu schüren. Denn Kriegsfurcht ist gut für die Erhöhung der Rüstung-Etats. Denke ich. Ich gehe sogar so weit, dass ich den Kapitalismus für den Hunger in der Welt verantwortlich halte.
13.09.2021 09:30:19 [Polit Platsch Quatsch]
Zeichen der Zeit: Im Schlafwagen zur Macht
Auf und nieder, immer wieder, jede Sonntagsfrage ein Schicksalsschlag und jede Wahlumfrage ein Etappensieg. Gebannt schauen die Kandidaten auf das jeweils jüngste Gerücht aus der Demoskopenküche, ihre Parteien wirken verunsichert, beunruhigt. Die Nerven sind bis zum Zerreißen gespannt. 23 oder 21, 12, 18 oder 7, es geht um Millimeter, jede neue Umfrageklatsche bringt neue Hiobsbotschaften, neue "Schocks" und neues Grauen. Die eigenen Fans sind keine mehr. Man möchte den Spitzenkandidaten wechseln. Der würde gern eine andere Partei führen, eine die hinter ihm steht oder zumindest wie die der Konkurrenten fein still schweigt.
13.09.2021 09:39:58 [Der Freitag]
Grüne Faschisten
Die Grünen tun so, als würden sie sich ohne Wenn und Aber gegen Diskriminierung und Ausgrenzung einsetzen. Tatsächlich machen sie selbst aktiv bei Diskriminierung und Ausgrenzung mit - ja, sie treiben das sogar selbst aktiv weiter voran.

Kürzlich fiel mir auf der Straße ein Wahlplakat der Grünen auf: Rassismus gehört ausgegrenzt. Sonst niemand.

Das stieß mir - selbst Ungeimpft - doch übel auf. Schließlich gehören ja gerade die Grünen zu den Parteien, die die Diskriminierung und Ausgrenzung von Ungeimpften besonders heftig vorantreiben - etwa durch eigene Politik in Baden-Württemberg oder durch immer weitergehende Forderungen von Frau Baerbock auf Bundesebene.

13.09.2021 12:00:55 [Polit Platsch Quatsch]
Auf dem Weg zum Klimathron
Wer mit Statistiken lügen will, hält sich am liebsten an Zahlen, die nicht erfunden sind, aber nach Belieben interpretiert werden können. Das Portal Statista, neben der Danachrichtenagentur DPA eine der Hauptquellen der von deutschen Medien weitergegebenen Informationen, hat es zu bewunderswerter Meisterschaft bei der Manipulation mit Daten gebracht, die in sich richtig, in der durch die Darstellung nahegelegten Interpretation aber falsch sind. So liegt China bei Statista "bei den Investitionen in die Energiewende im weltweiten Vergleich vorne" (Statista). Gleich dahinter folgen die USA, danach erst kommt Deutschland, der Staat weltweit, in dem mittlerweile jeder zweite Herzschlag einer fürs Klima ist. Traurig! Beschämend! Was für eine desaströse Bilanz!
13.09.2021 12:05:40 [Publico]
Die magische Kraft der Armbinde
Warum gibt es so viele Freunde des Ausnahmezustands? Er macht Leute wichtig, die es sonst nicht wären. Deutschland hat darin mehr Übung als andere Länder. In Deutschland heißt die Zeit zwischen den Lockdowns Sommer. So, wie der Sommer hier eine Übergangszeit zwischen zwei ähnlichen Zuständen markiert, liegt Deutschland seinerseits zwischen Ländern, die sich mit Covid-19 und allen seine Mutanten irgendwie arrangieren.
Also zwischen Italien einerseits, wo kein Restaurantbetreiber den Impfausweis sehen will, und Dänemark andererseits, das gerade alle Restriktionen für das öffentliche Leben abschafft. Hören Sie einfach weg, wenn Markus Söder sagt: Es wird keinen Lockdown mehr geben.

13.09.2021 15:37:43 [Telepolis]
"Deutsche haben Angst, wenn sie solidarisch sein sollen"
Über die jüngsten Sozialproteste in Berlin und die Reaktionen der etablierten Parteien. Ein Kommentar: "Zehntausende demonstrierten gegen Mietenwahnsinn", meldeten Presseagenturen über die Demonstration der "Mietrebellen" am 11. September in Berlin. Es besteht die Gefahr, dass auch diese Manifestation mit bis zu 20.000 Teilnehmenden im Hintergrundrauschen vor den Wahlen schnell vergessen wird. Schließlich gab es in den letzten Wochen jedes Wochenende Proteste in Berlin.

Von "Wer hat, der gibt" über "Unteilbar" bis zum "Widerstand gegen die Privatisierungspolitik" am kommenden Samstag reicht die Palette des Protestreigens im Vorfeld der Bundestagswahlen.

13.09.2021 17:23:28 [Peds Ansichten]
Nicht im Zusammenhang mit Corona
...sondern im Zusammenhang mit „Impfungen“ sterben und erkranken in diesen Monaten auffällig viele Menschen. Deshalb werden selbstredend pedantisch die an oder mit „Impfungen“ Verstorbenen und Erkrankten hochgezählt, richtig? Natürlich nicht. Denn das gilt nur für Corona. Hier wird also zweierlei Maß angewandt. So etwas nennt man Verzerrung, Framing, besser Desinformation. Kann man diesbezüglich Ärzten und Mitarbeitern der Behörden ein Umdenken zutrauen? Es gibt da keine Statistik, die jener von Corona auch nur annähernd gleichkommt. Nämlich eine, die im „Zusammenhang mit »Impfen« Verstorbene“ erfasst, diese marktschreierisch weiterreicht, wonach sie Tag für Tag bereitwillig wie ausschweifend von Politikern und Medien beklagt wird.
14.09.2021 06:31:01 [Friedensblick]
Mit lückenhaften Statistiken in die lückenlose Impf-Apartheid?
Laut RKI seien seit dem 1. Februar 30.880 Impfdurchbrüche registriert worden – also symptomatische Coronainfektionen mindestens zwei Wochen nach vollständiger Impfung, [1].
Das klingt harmlos (weniger als jeder tausendste Impfling), lenkt aber davon ab, dass das RKI zwei viel wichtigere Zahlen nicht hat (und auch gar nicht erheben will – warum auch immer), nämlich:

a) wie viele Geimpfte (mit oder eben auch ohne Symptome) eigentlich das Virus insgesamt bekommen haben und

b) wie viele dieser (nur offiziell?) 30.880 Impf-Durchbrecher einen schweren Krankheitsverlauf hatten.

14.09.2021 09:18:15 [Polit Platsch Quatsch]
In einem Land nach unserer Zeit
Ganz zum Schluss, als alle Messen gesungen waren, traute sich Ursula von der Leyen damals aus dem hermetisch abgeriegelten EU-Hauptquartier in Brüssel heraus. Die Kommissionspräsidentin, die der Ausbruch der Corona-Pandemie zurückgestutzt auf den Status jener Frühstücksdirektorin, als die sie nach Brüssel entsorgt worden war, verkündete im Nachtrab zu dem, was die nationalen Regierungen ohnehin nach langem Würgen und viel deutschen Widerstand beschlossen hatten, dass sie nun auch vorschlage, ganz Europa abzuriegeln.
14.09.2021 10:55:43 [Meine Meinung Meine Seite]
Wahlbetrug - gibt es sowas?
In nächster Zeit stehen da und dort Wahlen an. In Oberösterreich wird gewählt und auch in Graz. Und wenn man ORF- Nachrichten schaut, dann bekommt man den Eindruck – wegen der dafür aufgewendeten Sendezeit – dass die kommende Bundestagswahl in Deutschland für Österreich von größerer Bedeutung ist als die österreichische Nationalratswahl. Aber vielleicht sind das Nachwehen des „Ibiza- Skandals“, der ja für Kanzler Kurz eine willkommene Gelegenheit bot, die Regierung zu sprengen, neu wählen zu lassen und mit einem neuen, gefügigeren Koalitionspartner – den Grünen – in eine Koalition zu gehen. Und im Umgang mit Corona zeigt sich deutlich, dass die Grünen wesentlich mehr auf Linie der Kanzlerpartei ÖVP sind, als es die FPÖ wäre.
14.09.2021 13:00:52 [ScienceFiles]
Neil Oliver: Der Westen wird von bornierten Eiferern zerstört
Woran ich mich sehr klar erinnern kann, ist die Ahnung, die sich bei mir eingestellt hat, dass danach nichts mehr so sein würde wie zuvor, dass die Welt dauerhaft und unwiederbringlich verändert wurde. Das war zu viel, um es zu verarbeiten, zu undenkbar, zu furchtbar. Der Erste Weltkrieg wurde als Eisengitter beschrieben, das die Vergangenheit von der Gegenwart trenne. Man konnte durch die Eisenstäbe die alte Welt sehen, aber sie war für immer außer Reichweite. Wir hatten sie außer Reichweite gebracht. Wir konnten bestaunen, wie anders die alte Welt doch war. Aber wir konnten nicht mehr zurück zu ihr.
14.09.2021 14:35:03 [Peds Ansichten]
RKI-Geblubber im Dienste der Pandemie
Die RKI-Betrugsmasche steigender Fallzahlen ist ausgelutscht — und wird trotzdem weiter befeuert.

Nach wie vor werden diese Fallzahlen von regierenden Politikern benötigt, um immer neue, medizinisch hirnrissige Regeln (Stichwort x-G — Regeln) zu verordnen. Als neue Locke zur Verblödung einer verängstigten Bevölkerung hat man sich inzwischen der Intensivbettenauslastung stärker zugewandt. Wie sich rasch erfassen lässt, aber keinesfalls um eine Pandemie zu bekämpfen, NICHT um Menschen zu schützen. Wie lange werden sich die Menschen in ihrer Gesamtheit wohl noch täuschen lassen?

14.09.2021 16:30:28 [Antikrieg]
Covid, 9/11 & Krieg ohne Ende
Unsere Berichterstattung zum 11. September 2001, dem 20. Jahrestag, konzentrierte sich darauf, die Anschläge von 2001 durch die Linse der "Pandemie"-Einführung von Covid zu betrachten. Dabei geht es nicht darum, dass Covid19 und 9/11 notwendigerweise Teil desselben großen Plans sind, von denselben Personen ausgeführt wurden oder in irgendeiner Weise direkt miteinander verbunden sind. Vielmehr sind sie thematisch miteinander verbunden, und zwar auf der Metaebene.
14.09.2021 16:31:33 [Islampress]
AfD für Muslime wählbar?
Um die Frage zu beantworten, welcher Partei in der bevorstehenden Bundestagswahl der Muslim seine Stimme geben sollte, reicht es nicht hin, darauf zu schauen, wie der Islam in den jeweiligen Parteiprogrammen zur Sprache kommt, was der Bruder Muhammed Suçimez auf IslamiQ unter dem Titel „Was steht in den Wahlprogrammen zum Islam?“ in sorgfältiger Weise unternommen hatte. hm sei gesagt, daß es statt dessen vielmehr gelte, einmal darauf zu schauen, welche Partei unserem Lande, Deutschland, guttut oder gut zu tun verspricht.
15.09.2021 09:27:57 [Polit Platsch Quatsch]
Postergirl der Kinderarmut
So traurig ist das Schicksal des Mädchens in der roten Jacke. Seit dem ersten Auftauchen des todtraurigen Fotos im Jahre 2012, damals noch als Frontporträt des Mädchens mit glatzköpfiger Puppe, ist das Bild zu einer modernen Ikone gewachsen. Hunderte Male musste die arme Kleine ran, mit ihrer roten Jacke und der blau-weißen Mütze Armut verströmen in Taz und Cicero, FAZ und Welt, Neue Presse, Waz und Bild. Ein trauriges Kind aus Ostdeutschland, von allen guten Geistern verlassen, einsam in einer Plattenbausiedlung an der sprichwörtlichenn Straße der Gewalt. Irgendwie sah sie sogar missbraucht aus und sei es nur vom kalten Geist des Neoliberalismus, den die kahle Freifläche vor ihr verströmte wie die EZB den Todeshauch des Inflationalismus.
15.09.2021 09:50:23 [Apolut]
Statistikamt für Irreführung
Dass Deutschland von einer hohen Übersterblichkeit heimgesucht worden sei, suggerierte das Statistische Bundesamt in vielen Mitteilungen. Im vergangenen Dezember seien demnach 29 Prozent mehr Menschen gestorben als gewöhnlich, im Januar habe es 18 Prozent mehr Tote in der Bundesrepublik gegeben. Auch in einer zusammenfassenden Publikation für 2020 taucht immer wieder der Begriff „Übersterblichkeit“ auf.

Das Problem dabei: Die Statistiker operierten hier zumeist mit blanken Zahlen. Es fehlt die Analyse zur Entwicklung der Altersstruktur der Bevölkerung in Deutschland, also zur sogenannten demografischen Entwicklung.

15.09.2021 11:27:56 [Konjunktion]
Die Pandemie als Vorreiter für die “wahre Bedrohung”
In letzter Zeit, und nach einem globalen Angriff auf die Menschheit, der in der Geschichte beispiellos ist, nimmt die Ausweitung des “Neustarts” (aka Übernahme) der Gesellschaft durch die Internationalisten/Globalisten/Eliten (IGE) epochale Ausmaße an. Damit einher geht ein Ansturm von angeblichen Katastrophen, um die Massen in noch mehr Panik zu versetzen. Die führende, schon lange “gelebte” und nachdem die “Covid-19-Plandemie” abgeschlossen ist, Katastrophe wird wohl der uns seit Jahrzehnten eingehämmerte Betrug namens “Klimawandel” bleiben.
15.09.2021 11:29:42 [Antikrieg]
Nazismus, COVID-19 und die Zerstörung der modernen Medizin
Ein Interview mit Vera Sharav Vera Sharav: Wenn sich die Medizin vom Hippokratischen Eid entfernt, der verspricht, das Recht des Einzelnen zu respektieren und dem Einzelnen keinen Schaden zuzufügen, dann schadet man auch der Gemeinschaft, denn die Gemeinschaft ist ein Haufen von Individuen. Es gibt Kreuzungen im Leben, an denen man Entscheidungen treffen muss, und wenn man das nicht tut, wird jemand, der die Entscheidung für einen trifft, sie nicht in deinem besten Interesse treffen.
15.09.2021 11:51:05 [Unbesorgt]
Das ZDF träumt den Traum vom „Diversen Parlament”
„Dem deutschen Volke“ steht über dem Westportal des Reichstages in Bronze geschrieben und so wie nach dem Bau des Gebäudes 20 Jahre lang gestritten wurde, ob und welche Inschrift das Architav zieren solle, steht die Inschrift heute wieder in der Kritik: Nicht inklusiv, nicht divers genug. Indes hält man sich heute nicht mit der Beschriftung auf, es geht um den Inhalt des Gebäudes, die Zusammensetzung des Parlamentes, die nicht mehr in die Zeit passe. Das ZDF bereitet das Thema in einer interaktiven Webseite auf und klärt mit Versatzstücken zweier Politikwissenschaftlerinnen darüber auf, „welche Bevölkerungsgruppen im Bundestag fehlen – und warum das ein Problem ist“.
15.09.2021 13:45:48 [Tichys Einblick]
Als Ungeimpfter unter Geimpften – Ein soziales Experiment
Stellen Sie sich vor, Sie stoßen zu einer Versammlung von vielleicht zwanzig gebildeten Menschen im besten Alter unter freiem Himmel. Plötzlich fragt der Gastgeber, ob jemand in der Runde ungeimpft sei – und Sie, eine ehrliche Haut, heben die Hand. Als einziger. Ungläubiges Staunen ringsum, der eine oder andere der durchgeimpften „Versuchskaninchen“ (Olaf Scholz) nimmt schon mal Abstand und von Gesprächen am Wegesrand sind Sie fürderhin ausgeschlossen.

Tja. Das ist ein soziales Selbst-Experiment, zu dem man nicht raten kann. Also lieber lügen! Denn noch fordert niemand, alle Anwesenden mögen doch bitte ihren Impfnachweis vorweisen, „das ist ja nur zu Ihrer eigenen Sicherheit“.

15.09.2021 18:52:26 [Der Freitag]
So ein netter Kerl
Wäre Robert Habeck nicht der bessere Kandidat für die Grünen gewesen – gerade wegen seiner alternativen Art von Männlichkeit? Da hat sie also den Salat: Annalena Baerbock ist eine Frau. Gut, Sie warten womöglich auf eine Zugabe. Ja, was denn für eine Frau? Tut nichts zur Sache! Gleichberechtigung kann bitte schön nicht bedeuten, dass immer nur die Frau gewinnt. Weswegen es selbst den Grünen nahestehende Kommentatoren für einen taktischen Fehler hielten, zur Ablöse Angela Merkels eine Kanzlerkandidatin aufzustellen.
16.09.2021 06:49:45 [Antikrieg]
Sind die Vereinigten Staaten in ihrem Todeskampf?
Etwas sehr Unamerikanisches ist im Biden-Regime und in der gesamten westlichen Welt im Gange.

In dem Interview mit Vera Sharav (> LINK), das ich gestern gepostet habe, wies die bekannte Menschenrechtsaktivistin auf die außergewöhnliche Tatsache hin, dass die gewählten Präsidenten der westlichen Regierungen Covid-Edikte erlassen, als wären sie Diktatoren.

Mit anderen Worten, die gewählten Staatsoberhäupter in den Demokratien verstehen ihre verfassungsmäßige Rolle nicht mehr und sind bereit, zu versuchen, Macht auszuüben, die sie rechtlich oder verfassungsmäßig nicht haben.

16.09.2021 07:11:15 [Hinter den Schlagzeilen]
Ungeimpft und vogelfrei
Wer sich der Gen-Spritze verweigert, ist in Deutschland gesellschaftlich zum Abschuss freigegeben. Ungeimpft lebt es sich schwer im Deutschland des Jahres 2021. Die Luft wird immer dünner, der Spielraum gesellschaftlicher Teilhabe immer kleiner. Hinzu kommt, dass jene, die die Nadel ablehnen, an den gesellschaftlichen Rand gedrängt und entmenschlicht werden. Wie konnte es so weit kommen? Wie konnten sich in Deutschland in kürzester Zeit Abgründe auftun, von denen man eigentlich gedacht hätte, dass sie überwunden wären?
 Politik, Verfassung, Grundgesetz, Menschenrechte, Parteien, Wahlen, Demokratie, Recht, Gesetz und Justiz (93)
01.09.2021 06:40:18 [Die Kolumnisten]
Afghanistan und kein Ende
Nach dem Siegeszug der Taliban steht „der Westen“ vor einem humanitären Scherbenhaufen und sieht sich mit einer neuen Terrorgefahr konfrontiert. Es ist ein paar Monate her. In einem Asylverfahren konnte ich mir die Verhandlung vor meinem eigenen Termin anhören. Ein afghanischer Dolmetscher, der für die deutschen Truppen in Kabul gearbeitet hatte, sollte abgeschoben werden. Kein Asylgrund, meinte das BAMF. Nun ja. Der Partner des Klägers war bereits von den Taliban ermordet worden und dieser hatte es mit Hilfe seiner Familie auf den letzten Drücker geschafft, außer Landes zu kommen. Eine politische Verfolgung sah das BAMF nicht.
01.09.2021 06:49:46 [Junge Welt]
»Rot-rot-grüne« Heilsversprechen: Trübe Aussichten
Es geht um was, heißt es in den letzten Wochen vor der Bundestagswahl. Etwa um die Frage, welche dem Kapital verpflichtete Partei ihre Spitzenkraft ins Kanzleramt schickt. Und auch in den Reihen von Die Linke herrscht Anspannung. Dieses Mal soll es endlich klappen mit »Rot-Rot-Grün« im Bund. Weshalb? Dieses Land könne zum Positiven verändert werden, verkündete die Kovorsitzende Susanne Hennig-Wellsow am Montag. Falls es »arithmetisch passt«, wolle man in die Regierung – das sei »für uns klar wie Kloßbrühe«.

Dabei sind die Aussichten für Die Linke ziemlich trübe.

01.09.2021 09:03:33 [Reitschuster]
Warum die CDU jetzt dringend in die Opposition muss
Warum ist das Naheliegendste eigentlich so schwer zu schlucken für die Union und ihre Anhänger? Die CDU/CSU muss in der kommenden Legislatur in die Opposition. Eine Selbstreinigung im einfach nur fortlaufenden Regierungsgeschäft ist nicht mehr möglich.

Unglaubwürdig auch der Versuch, die kommende Bundestagswahl zur Schicksalswahl etwa gegen eine rot-rot-grüne Regierung aufzubauschen. Denn dann müsste das Bestehende als bessere Alternative erkennbar sein.

Aber wie soll der Wähler schlucken, was man nur mit Gewalt runterwürgen könnte: Die SPD ist Koalitionspartner einer Merkelregierung, die sich in 16 Jahren den Grünen angenähert und die gesamte Union dabei im Schwitzkasten festgehalten hat.

01.09.2021 10:59:45 [Deliberation Daily]
Koalitionsspielchen am grünen Tisch
Ich kenne mich nicht mit Spieltheorie aus und habe deswegen heldenhaft der Versuchung widerstanden, in der Überschrift des Artikels zu behaupten, spieltheoretisch verschiedene Aspekte der Koalitionsbildung im Herbst untersuchen zu wollen. Aber ein Tweet des Ökonomen Rudi Bachmann brachte mir innerhalb von fünf Minuten drei verschiedene Regungen hervor: „Ja, macht Sinn“, „nein, totaler Blödsinn“ und „hm, muss ich drüber nachdenken“. Das zeigt mir, dass die Überlegung grundsätzlich erleuchtend sein kann. Rot-Rot-Grün oder Grün-Rot-Rot: Das kommt nicht zustande. Selbst wenn es arithmetisch reicht, ist die Mehrheit zu schmal und die LINKE vollkommen unfähig zur Regierungsbeteiligung.
01.09.2021 12:38:00 [NachDenkSeiten]
Serie zur Bundestagswahl 2021 – ÖDP
Heute bieten wir unseren Lesern Informationen über die Ökologisch Demokratische Partei, die ÖDP. Den Eindruck von dieser Partei, die bundesweit wenig bekannt aber in Bayern schon mit Mandaten verankert ist, könnte ich vereinfacht so zusammenfassen: Allen bisherigen Wählern der BündnisGrünen, die wegen deren Neigung zu Kriegseinsätzen nahe am Verzweifeln sind, bietet sich bei der ÖDP eine Chance, eine Ersatzlösung bei der Stimmenabgabe. Es folgen Informationen zum Wahlprogramm, zur Wahlwerbung, zum Personalangebot und zu den Chancen.
01.09.2021 14:32:50 [Tichys Einblick]
Die Union wird Opfer ihrer Unterschiedslosigkeit zu SPD und Grünen
Gemessen an den Umfragen der vergangenen Monate haben sich die Wählerpräferenzen inzwischen so sehr verschoben, dass am 26. September nicht mehr die Union, sondern die SPD zur stärksten Partei werden könnte. Fände die Wahl schon heute oder morgen statt, würden laut der jüngsten INSA-Umfrage 25 Prozent Wähler der SPD und nur noch zwanzig Prozent der Union ihre Stimme geben, nachdem sie bei der Wahl 2017 noch 32,9 Prozent erreichte und letztes Jahr in Umfragen sogar bei 38 Prozent lag. Für die Grünen, die in Umfragen unlängst noch 25 Prozent erreichten, würden gleichzeitig nur noch 16,5 Prozent der Wähler stimmen. Auf dem Niveau lag vor kurzem in den Umfragen noch die SPD.
01.09.2021 14:35:55 [Kontext Wochenzeitung]
Mit Maske zurück an die Schule
Auch im zwanzigsten Monat der Pandemie sind Prognosen problematisch. Die Verunsicherung bleibt, erst recht, weil die Länder wieder eigene Wege gehen. In Baden-Württemberg hat die Inzidenz als Maßstab für das weitere Vorgehen ausgedient. Beschränkungen für Ungeimpfte wird es trotzdem geben. Nein, das ist kein Plädoyer für eine Impfung, sondern der Versuch einer Bestandsaufnahme. Denn noch ehe der dritte Corona-Winter richtig begonnen hat, äußert die Weltgesundheitsorganisation die Befürchtung, dass die Zahl von bisher 1,3 Millionen Toten in Europa noch einmal um 236.000 steigen könnte.
01.09.2021 15:43:01 [Ansage!]
Auf eine Willkürregel folgt die nächste
Nur auf den ersten Blick ist die Einführung eines neuen Bewertungsmaßstabs für gesundheitspolitische „Schutzmaßnahmen“ anstelle der bisherigen 7-Tages-Inzidenz, die Bundesgesundheitsminister Jens Spahn diese Woche ankündigte, ein Fortschritt. Tatsächlich wird eine willkürliche, aussagelose Regelung durch einen mindestens ebenso unausgegorenen, weil nicht objektiven Mechanismus ersetzt: Die „regionale Hospitalisierung“, die fortan der neue Maßstab ist.

Erstens ermöglicht das neue Gummi-Kriterium der „Hospitalisierung“ eine noch leichtere Manipulation der scheinbaren Alarmkriterien, mit denen die Politik dann fortan Notstandsmaßnahmen und Grundrechtseinschränkungen umsetzen kann.

01.09.2021 16:00:08 [IPG - Internationale Politik und Gesellschaft]
Demokratie-Schiedsrichter
Demokratien stehen derzeit weltweit unter Druck. Mit einem Gipfel wollen die USA ein Zeichen setzen. Im Alleingang wird ihnen das nicht gelingen. US-Präsident Biden wird am 9. und 10. Dezember einen globalen Demokratie-Gipfel abhalten. Aber keiner redet darüber. In den europäischen Medien und Debatten taucht das Thema nicht auf. Der Plan ist, dass sich die teilnehmenden Staaten zu konkreten Schritten verpflichten, um ihre eigene Regierungsführung zu stärken und Demokratie weltweit zu fördern. Im Dezember 2022 soll ein zweiter Gipfel die Umsetzung bewerten. Den Demokratie-Gipfel hatte Biden in seinem Wahlprogramm versprochen.
01.09.2021 17:56:12 [RT DE]
Scholz, Merkel - oder: Wo ist der "gewaltige Unterschied"?
"Merkel kanzelt Vize-Kanzler ab", titelt die "Bild" und gibt sich allergrößte Mühe, eine Nachricht zu erzeugen. Olaf Scholz, so der Vorwurf, ziehe eine Koalition mit der Linken in Betracht, und das gäbe es mit Angela Merkel nicht.

Die Bild hat den Bandwurmsatz, den Merkel als Antwort auf die Frage, ob Scholz eine Art Erbschleicherei betriebe, indem er sich auf die Große Koalition berufe, zurechtgestutzt und damit unauffällig entmerkelt. Man sollte schon den kompletten Text zu sich nehmen, der ehrlicherweise tatsächlich als ein einziger Satz niedergeschrieben werden muss.

01.09.2021 19:09:17 [Deliberation Daily]
Prädikat: Unfähig
Der Bundestagswahlkampf 2021 biegt auf die Zielgerade ein. Das zu einem Triell hochgejazzte Rennen zeigt die Parteien, die demnächst den Kanzler stellen wollen, Kopf an Kopf. Schon das ist eine Blamage für den eigentlichen haushohen Favoriten von den Konservativen, die noch vor Jahresfrist bei 40% lagen. Union und Grüne haben aufgrund ihres unfassbaren Dilettantismus schon jetzt so viel Schaden genommen, dass sie sich nur noch ins Ziel retten wollen. Dabei präsentieren die führenden Parteien Kandidaten, die das schwächste Politikangebot darstellen, die dieses Land je gesehen hat.
01.09.2021 19:28:49 [Brave New Europe]
Star Trek versus Imperialist Doctrine
On February 9, 1967, hours after the US Air Force pounded Haiphong Harbor and several Vietnamese airfields, NBC television screened a politically momentous episode of Star Trek. Entitled “The Return of the Archons,” the episode marks the debut of the Prime Directive – the supreme law of the fictional United Federation of Planets, and its Starfleet, banning any and all purposeful interference with alien people, civilizations, and cultures. Devised in 1966, as President Lyndon B. Johnson was sending another 100,000 troops into Vietnam, the Prime Directive constituted a direct, though well-camouflaged, ideological challenge to what the US government was up to.
06.09.2021 06:59:28 [Politica-Comment]
Wahlkampf 2021: Heisse Phase oder heisser Sch……?
Der Wahlkampf hat Fahrt aufgenommen, und die Privatsender haben offenbar das Infotainment als Crowdpuller entdeckt. So tourt Kanzlerkandidatin Annalena Baerbock seit ihrer Nominierung – unterbrochen von einer kurzen Pause “, bedingt durch ihre “Fehlerchen” wie Plagiate, Lebenslauf, Corona-Prämie und verpätete Meldung der Extra-Einkünfte – durch die Unterschichtenkanäle. Motto:

Kein schöner Fernsehwerbeland in dieser Zeit, als das der Privaten weit und breit.

06.09.2021 07:03:13 [Telepolis]
Corona: Drosten rechnet fest mit neuen Beschränkungen im Herbst
Es werde keinen Lockdown mehr geben, hieß es im Herbst 2020. Im November folgte dann ein "Teil-Lockdown".

Der Herbst 2021 ist ein neues Kapitel, so der bayerische Ministerpräsident und Beinahe-Kanzlerkandidat Markus Söder. Zumindest für Bayern, so stellte es Söder in Aussicht, werde es "einen neuen Lockdown oder Beschränkungen, wie wir sie hatten", definitiv nicht mehr geben.

Für Geimpfte und Genesene werde es im Herbst keinen weiteren Lockdown geben, so Bundesgesundheitsminister Spahn am Montag letzter Woche.

06.09.2021 07:05:15 [RT DE]
Das Comeback des Friedrich Merz
Spahn und Lauterbach sind zweifelhafte Lobbyisten, die die deutsche Politik ruinieren? Ja, gewiss doch. Aber jetzt holt der bedrängte Armin Laschet einen Wiedergänger auf die Bühne, der geradezu der Graf Dracula unter den Lobbyisten ist: Friedrich Merz. Drehtürpolitiker, so nennen Kritiker jene Parteivertreter, die zwischen der Politik und gut dotierten Jobs in der Wirtschaft hin- und herpendeln. Wenn es in dieser Gattung einen gibt, der das Spiel auf allerhöchster Ebene spielt, dann dieser: Friedrich Merz. Und dem Unionskandidaten Armin Laschet, dessen Umfragewerte kontinuierlich sinken, fiel nichts Besseres ein, als dieses Flaggschiff der konzerngesteuerten Politik wieder nach vorne zu schieben.
06.09.2021 07:14:44 [Reitschuster]
Der vollkommen desolate Moralkompass der Alena Buyx
Den Anfang staatlich orchestrierter systematischer Ungleichbehandlung machte am letzten Augustwochenende die Hansestadt Hamburg: Gastronomen und Veranstaltern wird seitdem der weitestgehend von Corona-Auflagen befreite Betrieb ihrer Einrichtungen gestattet – sofern sie ausschließlich Geimpfte und Genesene hineinlassen. Berlin zog ein paar Tage später mit einem ähnlichen Modell für Clubs und Diskotheken nach. Folglich beginnt NDR-Moderator Stefan Schlag sein Interview mit der Frage, ob Alena Buyx (ausgesprochen „Büx“) diesen „2G-Weg“ für vertretbar halte.
06.09.2021 07:35:34 [NachDenkSeiten]
Serie zu den Parteien im Wahlkampf: Die Freien Wähler
Die Freien Wähler sind auf der Bundesebene eine recht junge Erscheinung. Die Wurzeln der Partei liegen eher in der kommunalen und regionalen Politik. Hier prägen vor allem die bayerischen Freien Wähler das Bild, die mit ihrem Frontmann Hubert Aiwanger sogar als Koalitionspartner der CSU in der Regierungsverantwortung sind. Heute ist die Partei, die auf Bundesebene streng genommen auch eher ein extra für die Wahlen gebildeter Zusammenschluss verschiedener Landesgruppen ist, jedoch sogar im Europaparlament vertreten und will in diesem Jahr auch zum ersten Mal in den Bundestag einziehen.
06.09.2021 09:15:22 [Die Kolumnisten]
Nie war ich so unentschlossen wie vor dieser Wahl
Teil 3: Nachdem wir uns in den Teilen 1 und 2 mit Hartz 4 und dem Mindestlohn beschäftigt haben, wollen wir uns heute einem Thema zuwenden, das nicht jeder auf dem Radar hat, wenn er an seine zukünftige Wahlentscheidung denkt, welches ich als trockener Alkoholiker jedoch überaus spannend finde: Wie halten es die für den Bundestag kandidierenden Parteien mit den Drogen? Nicht im Sinne von: Was rauchen, schnupfen, werfen unsere Parlamentarier ein, bevor sie an die Rednertribüne des Plenums treten? Auch wenn das sicher ebenfalls aufschlussreich wäre.
06.09.2021 09:30:10 [TauBlog]
Zwischen Test und Simulation
Die Impfquote bereitet Sorgen. Sie ist nach Einschätzung der Experten wie Christian Drosten zu niedrig. Der Herbst könnte damit wieder zu einem klinischen Problem werden, eigentlich ziemlich sicher. Drosten geht davon aus, dass es ohne Kontaktbeschränkungen nicht gehen wird. Auf der anderen Seite gibt es vermehrt Impfdurchbrüche, die sich nicht mehr ignorieren lassen. Diese seien aber unproblematisch, da schwere Krankheitsverläufe eher selten sind. Das ist eine interessante wie auch manipulative Sichtweise, weil im Subtext erklärt wird, dass Ungeimpfte als Ungeschützte hauptsächlich mit schwerer Erkrankung rechnen müssen.
06.09.2021 09:33:51 [Deliberation Daily]
Die Guten, die Schlechten und die Irrelevanten
Teil 1: FDP und SPD. Sieht man sich die Wahlkämpfe an, die die sechs Parteien anlässlich der Bundestagswahl betreiben, so dürfte ins Auge fallen, dass nur zwei davon überhaupt einen Anspruch darauf erheben können, gute Wahlkämpfe zu sein, die die Chancen ihrer jeweiligen Partei auf große Stimmenanteile erhöhen. Das sind die der SPD und FDP. Letzteres ist keine allzu große Überraschung. Bereits 2017 überzeugte die Wahlkampfleitung der Lindner-Partei mit ihrem klaren Fokus, ihrem deutlich erkennbaren Stil und ihrer prägnanten Botschaft. Auch vier Jahre später haben die Liberalen diese Qualitäten nicht verloren.
06.09.2021 14:54:54 [Vera Lengsfeld]
Wer Scholz wählt, wählt Rot-Rot-Grün!
Wenn man noch verstehen kann, dass sich die Wähler massiv von der Union abwenden, ist der Aufstieg der SPD völlig unverständlich. Offensichtlich wirkt die Plakatkampagne der Sozialdemokraten, die ihren Spitzenkandidaten als einschläfernden Opa präsentiert, der nichts Böses anrichten kann. Dank der Medien, die ihre Kontrollfunktion aufgegeben und sich dem Aktionismus zugewandt haben, bleiben Scholz politische Leichen im Keller. Dabei sind sie geeignet, die Eignung von Scholz als Kanzlerkandidat in Frage zu stellen.


06.09.2021 14:59:29 [Verfassungsblog]
Die Bundestagswahl 2021 unter den Bedingungen der Pandemie
Zu den ungelösten Problemen im rechtlichen Umgang mit der Corona-Pandemie gehört das Verhältnis von Infektionsschutzrecht und Wahlrecht. Darf die Ausübung des Stimmrechts an infektionsschutzrechtliche Auflagen, etwa das Tragen einer Maske oder die Vorlage eines negativen Coronatests, geknüpft werden? Die Kommunalwahlen in Bayern im Frühjahr 2020 in der Frühphase der Pandemie hatten insoweit noch nicht zu größeren Verwerfungen geführt (s. dazu Lindner, hier und hier). Zwar wurde der zweite Wahlgang – also die Stichwahl – als obligatorische Briefwahl durchgeführt.
06.09.2021 15:14:26 [NachDenkSeiten]
Impf-Skepsis ist politisch – nicht egoistisch
Die Impfstatus-Abfragen werden wahrscheinlich ebenso kommen wie der (mindestens) indirekte Impfzwang. Widerstand gegen diese Vorhaben ist weder „egoistisch“ noch „bequem“, wie es nun behauptet wird: Dieser Widerstand ist ein (höchst unbequemer) Dienst an der Gesellschaft. Wenn jetzt kein Widerstand geleistet wird, drohen in der Zukunft Wiederholungen einer destruktiven, auf Panik-Kampagnen aufgebauten Politik. Darum kann Impf-Skepsis nicht nur gesundheitlich, sondern auch politisch gut begründet sein.
06.09.2021 17:16:36 [RT DE]
Hilfe! Der Wahl-O-Mat macht mich zum Nazi!
Seit Mittwoch ist der Wahl-O-Mat zur anstehenden Bundestagswahl online. Während beispielsweise der Klimawandel, Migration und Gender viel Platz einnehmen, fallen Themen wie die Corona-Krise, die deutsche NATO-Mitgliedschaft oder soziale Fragen kaum ins Gewicht. Umso kurioser sind oftmals die Ergebnisse. Ein politisches – vom Wähler goutiertes – "Weiter so!" nach dem 26. September ist daher durchaus erwünscht – ob nun mit CDU, SPD oder den Grünen an der Spitze (die Unterschiede sind sowieso marginal), ist relativ egal.
06.09.2021 18:55:03 [Verfassungsblog]
Wie sich das Parlament in der Pandemie mal wieder selbst aus dem Spiel nimmt
Kurz vor der Bundestagswahl am 26. September 2021 diskutiert der Deutsche Bundestag eine weitere Änderung des Infektionsschutzgesetzes, es wird die neunte sein seit Beginn der Corona-Pandemie im März 2020. Bemerkenswert ist nicht nur der Inhalt der vorgeschlagenen Änderung, immerhin die Abkehr von der Sieben-Tage-Inzidenz als Richtwert der Epidemiebekämpfung, sondern vor allem der bisherige Verfahrensverlauf im Deutschen Bundestag: Er zeigt exemplarisch, mit welcher Priorität die Koalitionsfraktionen die legislative Steuerung der Epidemiebekämpfung als Aufgabe des Bundestags behandeln – nämlich mit überhaupt keiner. Damit nimmt sich das Parlament in der Pandemiebekämpfung selbst aus dem Spiel, wie die folgende Chronologie zeigt.
06.09.2021 18:59:58 [RT DE]
Warum hat Deutschland keine Verfassung?
Gegenseitige Kontrolle sollte einmal sicherstellen, dass die Rechte, die im Grundgesetz stehen, auch gewahrt bleiben. Von beidem ist nicht mehr viel übrig. Politik, Justiz, Medien, selbst Wissenschaft sind so verflochten, dass Kontrolle nur noch Illusion ist. Was wäre der Ausweg? Auf diese Frage gibt es viele und keine Antworten. Da fehlt nur noch meine allgemeinverständlich, ohne juristische Spitzfindigkeiten erklärte Begründung. Eine Verfassung ist nur eine solche, wenn sich ein Volk diese selbstbestimmt und in freier Entscheidung gibt, was bedeutet, dass die Menschen insgesamt darüber abstimmen.
07.09.2021 06:47:32 [RT DE]
Annalena und die verdrängte Wahrheit über Rot-Grün
Es gibt ein Phänomen des menschlichen Geistes, das immer dann zum Zug kommt, wenn man schmerzliche oder zumindest unangenehme Informationen nicht wahrnehmen will: Es nennt sich Verdrängung. Grünen-Kandidatin Annalena Baerbock lieferte dafür gerade ein Lehrbuchbeispiel. Sich über die Kanzlerkandidatin der Grünen Annalena Baerbock lustig zu machen, erfordert nicht viel Mühe. Schließlich reichen Aufnahmen ihrer zahlreichen Versprecher oder Lebensläufe. Manchmal allerdings sagt sie Dinge, die nicht schlicht mit einem überforderten Verstand erklärt werden können. Wie jetzt wieder.
07.09.2021 07:10:34 [Verfassungsblog]
Die List(e) mit den „kleinen sicheren Herkunftsstaaten“
Zur verfassungswidrigen Idee, unter dem Deckmantel des Unionsrechts weitere Staaten als „sicher“ einzustufen. Im aktuellen Wahlkampf spielen die Themen Flucht und Migration nur eine untergeordnete Rolle, sieht man einmal vom Afghanistan-Debakel ab. Und doch hat die Idee einer Liste mit „kleinen sicheren Herkunftsstaaten“ Eingang in das gemeinsame Wahlprogramm der CDU und CSU gefunden. Anders als bei den herkömmlichen „sicheren“ Herkunftsstaaten, soll sich die Sicherheitsvermutung der dort gelisteten Staaten nur auf den unionsrechtlich determinierten Flüchtlingsschutz und subsidiären Schutz beziehen.
07.09.2021 09:35:20 [Tichys Einblick]
Die Warnung vor dem Linksrutsch wird die CDU nicht retten
Schon 1994 war die Kampagne umstritten: Um der lahmenden CDU-Wahlkampagne zum Bundestag Schwung zu geben ließ der damalige Generalsekretär der CDU, Peter Hintze, Wahlplakate mit roten Socken kleben. „Auf in die Zukunft … aber nicht auf roten Socken“ stand darauf.

Kurz davor war die Landtagswahl in Sachsen-Anhalt für die CDU verheerend ausgegangen; Kohls Versprechen von den „blühenden Landschaften“ glaubten immer weniger Menschen in den neuen Bundesländern, deren Jobs über Nacht verloren waren. In Sachen-Anhalt ließ sich die rot-grüne Landesregierung von Ministerpräsident Reinhard Höppner von der PDS, der Nachfolgepartei der SED und Vorgängerin der Linken, tolerieren.

07.09.2021 11:45:48 [Deliberation Daily]
Die Guten, die Schlechten und die Irrelevanten
Teil 2: CDU und Grüne. Aus heutiger Sicht ist es geradezu absurd, dass noch vor einem halben Jahr die Frage war, ob der nächste Kanzler eine Kanzlerin und Grüne sein würde – oder ob die CDU doch die Oberhand in einer schwarz-grünen Koalition behalten würde. Müsste man die dann „Große Koalition“ nennen, nachdem die SPD auf einen Tiefpunkt von 12% in den Umfragen gestürzt war? Ah, lang, lang ist’s her. Seit der offiziellen Ausrufung Anna-Lena Baerbocks als Kanzlerkandidatin Mitte April 2021 läuft es für die Grünen so schlecht, dass ich zwischendurch die Frage stellte, ob sie eigentlich überhaupt gewinnen wollen.
07.09.2021 13:30:20 [TauBlog]
Den Amtsbonus aus den Augen verloren
Das Problem der Union ist nicht Laschet, sondern Merkel, die ja bis zum Ende der regulären Amtszeit regiert. Normalerweise war es bislang immer so, einen scheidenden Regierungschef noch während der Wahlperiode, meist zur Mitte abzuziehen und durch den gewünschten Nachfolger zu ersetzen, damit der noch Punkte machen kann. Jetzt ist es ja so, als könne ausgerechnet Olaf Scholz den Amtsbonus von Merkel ausspielen. Eine clevere Strategie übrigens, die von der Union viel zu spät durchschaut wurde.

Die Frage ist natürlich, ob die SPD einen Kanzlertausch in dieser Wahlperiode mitgemacht hätte. Im Raum stand es jedenfalls nie.

07.09.2021 13:42:04 [Junge Welt]
Debatte über Linke-Kurs: Rot und rosé
Im politischen Karneval des Wahlkampfes 2021 gibt es ein neues Kapitel: Die Führung der Linken will partout mitregieren und sagt auch, was sie alles will. Ohne vorherige Diskussion oder gar Beschlussfassung dazu im Parteivorstand schafft die Regierungslinke vollendete Tatsachen. Am Montag stellten die Spitzenkandidaten Dietmar Bartsch und Janine Wissler ihr »Sofortprogramm für einen Politikwechsel« vor. Die im April 2020 von Katja Kipping, Bernd Riexinger, Jörg Schindler und Harald Wolf angekündigte »offensive« Vertretung des »Ziels eines Politik- und Regierungswechsels« bei den »künftigen Bundestagswahlen« hat sich damit durchgesetzt.
07.09.2021 13:45:16 [Rationalgalerie]
Wahl und Bewegung: Die „dieBasis“ nimmt späte Fahrt auf
Nicht selten gingen den deutschen Parteien Bewegungen voraus. Selbst die SPD, die heute so leblos wirkt, als wollte sie sich nie wieder in Bewegung setzen, stammt aus Formationen, die vor der Partei entstanden sind. Wer in der SPD wird noch wissen, dass ihr Vorläufer, die „Allgemeine Deutsche Arbeiterverbrüderung“ rund um die 48er Revolution entstanden ist? Die GRÜNEN stammen tatsächlich auch aus der westdeutschen Friedensbewegung, aber das wollen sie auf keinen Fall mehr wissen. Die CDU ist eine Nachfolgeorganisation der Zentrumspartei, deren Vorläufer, die „Soester Konferenzen“ waren, eine Art katholischer APO gegen das protestantische Preußen, die sich auch im Umfeld der 48er Revolution sammelte.
07.09.2021 15:22:01 [Verfassungsblog]
Fake-Strafrecht in Wahlkampfzeiten
Warum sich das Strafrecht nur bedingt zum Schutz vor Fake News und Deep Fakes eignet

Von einer Kandidatin kursieren angebliche Nacktbilder, ein anderer Kandidat soll Spenden für Flutopfer für seinen Wahlkampf verwenden. Der Bundeswahlleiter stellt auf seiner Website sicherheitshalber klar: „Es gibt keine Gewinnspielteilnahme bei der Stimmabgabe zur Bundestagswahl.“ In Wahlkampfzeiten verbreiten sich immer mehr Falschinformationen dieser Art. Genügen die Aufklärung durch Staat und Medien, um den Gefahren zu begegnen, die heute von Fakes ausgehen?

07.09.2021 15:37:46 [NachDenkSeiten]
Das „Bekenntnis zur NATO“ und die Heuchelei um Krieg und Koalitionen
Mit absoluten Forderungen an die LINKE nach einem „Bekenntnis zur NATO“ schließen prominente SPD-Politiker ein rot-rot-grünes Bündnis kurz vor der Wahl in der Praxis weitgehend aus. Das ist politisch falsch und inhaltlich geheuchelt: Der problematische Charakter der NATO trat selten so offen zutage wie im Moment. Die LINKE sollte die Forderungen, die auch von den Grünen kommen, im Interesse der Friedenspolitik und im Interesse der eigenen Wahlchancen zurückweisen. Die Signale sind verwirrend: Auf der einen Seite verteidigte gerade der Ko-SPD-Chef Walter-Borjans, dass SPD-Kanzlerkandidat Olaf Scholz eine Koalition von SPD, Grünen und Linkspartei noch nicht ausgeschlossen habe.
07.09.2021 17:22:59 [NachDenkSeiten]
Die Virus-Politik ist der neue „Krieg gegen den Terror“
Harte Zeiten, harte Pflichten: Ist der „Krisenmodus“ erst einmal installiert, dann herrschen Emotionen statt Fakten, Religion statt Ratio – wo gehobelt wird, da fallen schließlich Späne. Innerhalb dieses Propaganda-Nebels können die Verhältnisse geformt werden. Das Beispiel 9/11 zeigt: Auf Panik-Kampagnen aufgebaute Repressionen haben eine lange Lebensdauer – die nach 2001 von Propagandisten und Politikern vorangetriebenen „Anti-Terror-Gesetze“ sind zum großen Teil bis heute in Kraft. Das sollte eigentlich eine Lehre sein – doch die wird in den medialen Wind geschlagen.
07.09.2021 18:58:50 [Politica-Comment]
Film Curveball, der Irakkrieg, und der Bundesnachrichtendienst
In den Kinos läuft zur Zeit der Film Curveball an, der schildert, wie der BND auf einen angeblichen Top-Spion hereinfiel, und dessen “Erkenntnisse” den USA als Rechtfertigung für den Irakkrieg 2001 dienten: der Irak solle angeblich Massenvernichtungswaffen besitzen und produzieren, und die müsse man unschädlich machen. Auch der damalige britische Premier Tony Blair behauptete im Parlament, es gehen nicht um einen Machtwechel in Bagdad, sondern um die Beseitigung einer Bedrohung durch irakische Massenvernichtungswaffen.

In Wirklichkeit gings es natürlich um den Zugriff auf irakisches Erdöl, wie der damalige US-Notenbankchef Alan Greenspan später freimütig zugab.

08.09.2021 07:00:32 [Deliberation Daily]
Plädoyer für ein neues Lagerdenken
Politik in Deutschland wird gerne in „Lagern“ gedacht. In den 1990er und frühen 2000er Jahren waren das das rot-grüne gegen das schwarz-gelbe Lager. Seit der Wahl 2005 wird gerne ein „linkes Lager“ aus SPD, LINKEn und Grünen aufgemacht. Konservative Politiker, die zumindest auf Landesebene gerne mit der AfD zusammenarbeiten würden, sprechen gerne von einem „bürgerlichen Lager“, in das sie dann einen unbestimmten Teil zumindest der AfD-Wählendenschaft, wenn nicht der Abgeordneten selbst, hinzurechnen. Aber obwohl diese Begrifflichkeiten viel verwendet werden, ist seit 2013 keine Koalition in irgendeinem dieser Lager realistisch gewesen.
08.09.2021 09:45:47 [Der Freitag]
Postdemokratie in Echtzeit
Eine Überraschung war die Afghanistan-Krise nicht. Und wer versucht, die ausgebliebene Vorbereitung auf eine schnelle Machtübernahme durch die Taliban so zu rechtfertigen, läuft daher auch in eine Sackgasse. Warum aber scheint sich die Bundesregierung trotzdem nicht auf das gegenwärtige Szenario vorbereitet zu haben? Gab es nicht genügend lautstarke Stimmen, die davor gewarnt hatten, dass auf den angekündigten Abzug der Vereinigten Staaten zeitnah auch eine erneute Machtübernahme der neuen alten Herrscher folgen würde? Ein Großteil der jetzigen Situation ist sicherlich mangelhafter Planung und damit auch verantwortlichen Personen in Regierungsverantwortung anzulasten.
08.09.2021 11:25:45 [Tichys Einblick]
Unterirdische Wahlplakate: Moralischer Totalausfall
„Die Partei“ verspottet gerne das politische System und vor allem ihre Gegner von „rechts“ an Straßenlaternen mit niederen Instinkten. Satire darf laut Kurt Tucholsky „alles!“. Im Bundestagswahlkampf erlaubt sich „Die Partei“, diesen Vorsatz eines deutschen Dichters politisch auf den Straßen umzusetzen. „Hier könnte ein Nazi hängen“, droht die Truppe von Parteichef Martin Sonneborn, der vom Steuerzahler alimentiert seit 2019 sogar als Abgeordneter im EU-Parlament sitzt. Keinen Empörungsjournalisten regt dieses Hängen an den Straßenlaternen auf – es geht ja vermeintlich gegen Nazis.
08.09.2021 11:30:03 [Der Freitag]
Bundestagswahl: Niedergang der Linkspartei?
Die Linkspartei will unbedingt Teil der neuen Regierungskoalition sein. Das wird nur möglich sein, wenn sie sich den Forderungen der SPD und Grünen vollends unterwirft. Die Linkspartei bringt sich in Stellung. In weniger als drei Wochen wird der neue Bundestag gewählt, der aktuellen Umfragen zufolge die Unionsparteien in die Opposition verbannen könnte. Die Sozialdemokratische Partei Deutschlands (SPD) liegt mit 5 Prozentpunkten vor der Union (INSA) und kann hiernach den Anspruch erheben, den Kanzler zu stellen, wenn eine realistische Koalition zustande kommen kann.
08.09.2021 11:34:56 [Deliberation Daily]
Die Guten, die Schlechten und die Irrelevanten
Teil 3: AfD und LINKE. Der Wahlkampf 2017 wurde völlig von der AfD dominiert. Ihre Themen waren permanent in den Nachrichten, das komplette TV-Duell war auf ihre Narrative hin ausgerichtet, und wenig überraschend fuhr sie ein starkes Ergebnis und ein zog und in den Bundestag ein. Die LINKE dagegen hat es bereits seit 2013 eher schwer. Die Einführung des Mindestlohns nahm ihr eines ihrer wichtigsten Themen, Hartz-IV wurde deutlich entschärft, und Afghanistan interessierte praktisch niemanden. Zwar konnte sie stets auf ihre Stammwählendenschaft bauen, die sie verlässlich um die 8%-Marke schweben ließ, aber jedes zweistellige Ergebnis stellte einen großen Sieg dar – und die Regierungsbeteiligung blieb der weiße Elefant, der nicht zu erreichen war.
08.09.2021 11:41:50 [M 7]
Außenpolitik: Das Phänomen der Verdrängung
Alle Pläne, in einem Land Politik machen zu wollen, hängen davon ab, ob der Frieden gesichert ist. Kommt es zu kriegerischen Zuständen, ist die zivilisatorische Gestaltung eines Gemeinwesens gefährdet. Nun kann man unterschiedlicher Meinung darüber sein, welche Art der Außenpolitik den Frieden sichert, aber man kann nicht mehr darüber streiten, wenn man sich bereits in einer Entwicklung befindet, die als eine Form der Vorbereitung kriegerischer Auseinandersetzungen befindet. Umso schwieriger wird es, wenn die Beteiligung an militärischen Aktionen bereits zu den Standards zählt, die als Normalität bezeichnet werden.
08.09.2021 13:46:52 [Krass & Konkret]
Und sie bewegt sich doch
Was ist möglich bei der Bundestagswahl?



Monatelang schien der Ausgang der Bundestagswahl im Grundsatz klar. Es ging eigentlich nur noch um die Frage Grün-Schwarz oder Schwarz-Grün. Bündnis90/DieGrünen standen nach der Nominierung von Baerbock kurzfristig bei ca. 26%. Die CDU, man mag es heute kaum noch glauben, zog nach der Entscheidung für Laschet dann zwischenzeitlich auf 28% an. SPD und LINKE dümpelten vor sich hin. Für Letztere gilt das auch jetzt noch. AfD und FDP waren relativ konstant.

Dann leistete sich Annalena Baerbock einige Patzer, die Medien wurden wach.

08.09.2021 17:11:55 [SoZ - Sozialistische Zeitung]
„Mehr investieren, damit Gewehre auch schießen“
Dass die Grünen an der nächsten Bundesregierung beteiligt sein werden, hat eine hohe Wahrscheinlichkeit. Viele Menschen erwarten davon Fortschritte in der Umwelt- und Gesellschaftspolitik. Von dieser Illusion sollten sie sich schnellstens verabschieden: Die militärpolitische Orientierung der Grünen zeigt, dass sie keineswegs gewillt sind, die Interessen der Besitzenden im mindesten in Frage zu stellen.

Dass in Deutschland unter den aktuellen Machtverhältnissen nur regiert, wer sich rückhaltlos zum Krieg bekennt, wusste schon der designierte Außenminister Joseph Fischer, als er – bereits gewählt, allerdings noch nicht im Amt – im Oktober 1998 zusammen mit dem künftigen Kanzler Gerhard Schröder (SPD) der damaligen US-Regierung versicherte, an ihnen werde ein Angriffskrieg gegen Jugoslawien nicht scheitern.

08.09.2021 17:19:36 [Telepolis]
Umfragen: Union trudelt auf unter 20 Prozent
CDU und CSU rutschen bei Forsa unter 20 Prozent. In Bayern, wo früher "40 oder gar 50 plus Prozent" als Ziel ausgegeben wurde, weisen erste Umfragen auf ein Absacken unter 30 Prozent hin.

Der Union geschieht nun, was viele voraussagten: Wie zuvor die SPD trudelt die Volkspartei CDU und ihr kleines bayerisches Geschwister kontinuierlich nach unten. Wann und wo der Fall stoppt, weiß keiner. Es bleiben nur mehr 17 Tage für das "Zukunftsteam" mit Friedrich Merz, um eine Trendwende für den Kandidaten Laschet herbeizuführen. Medienberichte protokollieren genüsslich, dass sich Ideen für einen Umkehrschub rarmachen

08.09.2021 19:03:54 [Kontext Wochenzeitung]
Afghanistan: Tödliche Politik
Der Bundesregierung sind afghanische Menschenleben ganz offenbar gleichgültig. Das zeigt nicht nur die verschleppte und nunmehr gescheiterte Rettung der Ortskräfte. Es lässt sich auch an den jahrelang praktizierten Abschiebungen ablesen. Ein persönlicher Bericht, was das bedeuten kann: Kürzlich war es so weit. Der letzte amerikanische Flieger verließ Afghanistan. Der Abzug der US-Truppen war vollzogen und die Taliban feierten den historischen Moment mit Jubelschüssen und Raketen, die den Nachthimmel erleuchteten. Währenddessen konnten viele Einwohner Kabuls nicht schlafen. Sie gerieten in Panik und dachten anfangs, dass Gefechte auf den Straßen ausgebrochen seien.
09.09.2021 09:33:04 [Telepolis]
Was heißt im Einklang mit "der Scharia"?
In den vergangenen Tagen war mal wieder der Begriff "Scharia" medial stark präsent. Bundesaußenminister Heiko Maas von der SPD verkündete in der Tagesschau absurderweise, dass Deutschland keinen Cent mehr nach Afghanistan geben wird, "wenn die Taliban komplett übernommen haben, die Scharia einführen und dieses Land ein Kalifat wird".

Wenn es das Ziel der Bundeswehr mit ihrem Einsatz in Afghanistan gewesen sein soll, die Einführung der Scharia zu verhindern, dann muss man an dieser Stelle festhalten, dass dieses Vorhaben schon von Beginn an gescheitert ist.

09.09.2021 11:43:33 [Netzpolitik]
Wikipedia: Mit freundlichen Edits aus dem Bundestag
Zu den meistgeklickten Artikeln in der deutschsprachigen Wikipedia gehört aktuell „Bundestagswahl 2021“, dicht gefolgt von denen der Kanzlerkandidaten Annalena Baerbock und Olaf Scholz. 677 Millionen Mal wurde die Online-Enzyklopädie im August von deutschen IP-Adressen aufgerufen.

Für viele ist Wikipedia die erste Anlaufstelle, um sich zu informieren. Doch immer wieder gab es gerade vor politischen Ereignissen Manipulationsvorwürfe. Schon 2005 stand der Artikel des NRW-Wahl-Spitzenkandidaten Jürgen Rüttgers unter Verdacht. Vor zwei Jahren soll ein SPD-Genosse während des Kampfs um den Parteivorsitz die Beiträge von Olaf Scholz und Klara Geywitz aufgehübscht haben.

09.09.2021 13:28:03 [Junge Welt]
CSU in der Krise: Panik in München
Alte Hüte und rote Socken sind bei der Union derzeit in Mode. CSU-Chef Markus Söder gehört zu denen, die seit Tagen mit einer Neuauflage der »Rote-Socken-Kampagne« aus den 90er Jahren auf die desaströsen Umfragewerte der Union antworten. Seine Warnung vor einem »historischen Linksrutsch« bei der Bundestagswahl sorgte Ende August bereits für viel Spott. Es herrscht offenbar nackte Panik in der Münchner CSU-Zentrale. Seit Dienstag gibt es für Söder zwei Gründe mehr, mit unguten Gefühlen auf den 26. September zu schauen: Die CSU rutschte in einer Umfrage für Bayern unter die Marke von 30 Prozent.
09.09.2021 13:33:14 [Deliberation Daily]
Die Guten, die Schlechten und die Irrelevanten (Collector’s Edition)
Sieht man sich die Wahlkämpfe an, die die sechs Parteien anlässlich der Bundestagswahl betreiben, so dürfte ins Auge fallen, dass nur zwei davon überhaupt einen Anspruch darauf erheben können, gute Wahlkämpfe zu sein, die die Chancen ihrer jeweiligen Partei auf große Stimmenanteile erhöhen. Das sind die der SPD und FDP. Letzteres ist keine allzu große Überraschung. Bereits 2017 überzeugte die Wahlkampfleitung der Lindner-Partei mit ihrem klaren Fokus, ihrem deutlich erkennbaren Stil und ihrer prägnanten Botschaft. Auch vier Jahre später haben die Liberalen diese Qualitäten nicht verloren. Wesentlich überraschender ist die gute Performance der SPD, die seit 2005 wahrlich nicht an einem Überschuss guter Wahlkämpfe litt.
09.09.2021 18:46:00 [Kontext Wochenzeitung]
Südwest-CDU: Zu viele falsche Antworten
Dass er sich da mal nicht irrt: Armin Laschet glaubt, "ohne große Teile" der Südwest-CDU wäre er heute nicht Bundesvorsitzender. Sein Vize Thomas Strobl nickt auf der gemeinsamen Pressekonferenz in Heidelberg aber an ganz anderer Stelle. Nämlich als der Kanzlerkandidat sagt, er wisse, wie viele Merz-Fans es hierzulande gab. Ein Widerspruch und doch einer der kleineren, die zu jener Verunsicherung beitragen, die sich in den desaströsen Umfrageergebnissen niederschlagen. Auch diesmal will die CDU alle 38 Direktmandate zwischen Main und Bodensee erobern. Landtagsfraktionschef Manuel Hagel hat erst kürzlich dieses ehrgeizige Ziel bekräftigt, trotz des demoskopischen Sinkflugs.
09.09.2021 18:51:08 [Tichys Einblick]
Das wars, liebe Union! Tschüss!
Eine CDU-Politikerin hat den heuchlerischen Vorhang von der traurigen C-Parteien-Realität weggezogen. Selbst die Enkel meiner Generation kennen ihn, einen der legendärsten O-Töne der Geschichte: „Aus, aus, aus! Aus! Das Spiel ist aus!“ So kommentierte Sportreporter-Legende Herbert Zimmermann den Abpfiff des Fußball-WM-Finales am 4. Juli 1954 im Wankdorf-Stadion von Bern. Seit heute ist es nun der Wahl- und Wappenspruch von CDU und CSU. Doch sie sind nicht Weltmeister, nein, sie sind Mitarbeiter des Jahres der SPD. Auch der AfD. Diese Parteien können nun den Wahlkampf einstellen. Der politische Hauptgegner kann die Sektflaschen knallen lassen.
10.09.2021 06:37:49 [Post von Horn]
Parteien: Kein Respekt mehr vor den Wählern
Die Bürger haben schwer zu tragen. Noch ist Corona nicht besiegt, da gilt es, den aktuellen Bundestagswahlkampf zusätzlich zu verkraften. Schon seine Vorgänger 2013 und 2017 gestalteten die Parteien als Zumutung. Im Wahljahr 2021 legen sie es darauf an, die Wähler noch stärker zu strapazieren. Die Parteien machen sich nicht mehr die Mühe, den Wählern Respekt zu erweisen. Die Pandemie legte bloß: Die Abgeordneten in Bund und Ländern haben das Land von Wahlperiode zu Wahlperiode herunter gewirtschaftet. Das Schulsystem erstickt an föderaler Vielfalt und technischer Rückständigkeit.
10.09.2021 11:37:37 [Ansage!]
Manipulation per Wahl-O-Mat
Noch nie war vor einer Bundestagswahl soviel Unentschlossenheit, soviel Ratlosigkeitkeit, soviel Frustration und Perplexität unter den Wahlberechtigten wie bei dieser. Die bis zur inhaltlichen Beliebigkeit reichende, weitestgehende Konturlosigkeit zumindest des „Altparteienkartells“ mit ihrer in vielen Punkten austauschbaren Programmatik erschwert die Wahlentscheidung zusätzlich. Wobei diese für die meisten Deutschen ohnehin nur zwischen besagten etablierten Parteien erfolgen, keinesfalls jedoch die AfD einschließen darf.
10.09.2021 11:42:52 [TauBlog]
In der Sackgasse angekommen
Es bleibt dabei, das aggressive Werben der Behörden für eine Impfung dient weniger der Gesundheit der Bevölkerung als vielmehr einer Politik, die ihr Scheitern bei der Pandemiebekämpfung kaschieren will. Ungeimpfte sind daher gewissermaßen auch das Sinnbild für das Versagen der Regierung. So lange es diese Gruppe gibt, kommen die Verantwortlichen aus der Sackgasse, in die sie sich nun hinein manövriert haben, nicht mehr heraus. Bislang hat man es mit Drohungen probiert, wie dem allseits beklatschten Ausschluss aus dem öffentlichen Leben oder der Einführung kostenpflichtiger Tests. Erfolgreich ist das mit Blick auf die Impfquote jedoch nicht.
10.09.2021 13:18:02 [Der Freitag]
Bundestagswahl: Links liegengelassen
Die Kultur wurde schon während der Pandemie vernachlässigt. Jetzt wird sie auch im Wahl-O-Mat mit keiner Frage erwähnt. Zu allem darf man eine Meinung haben. Sei es das Kopftuch für Beamtinnen, sei es die Pipeline Nord Stream 2, sei es die Förderung von ökologischer Landwirtschaft oder die sprachliche Berücksichtigung von Geschlechtsidentitäten. Nur Kultur, ausgerechnet, bleibt beim Wahl-O-Maten außen vor, den die Bundeszentrale für politische Bildung (bpb) vor ein paar Tagen freigeschaltet hat: „Kulturlos“ sei die Entscheidungshilfe, beschwerte sich der Deutsche Kulturrat am Sonntag in einer Pressemitteilung. Bei den 38 Thesen, die von der bpb ausgewählt wurden und die aus – siehe oben – ganz verschiedenen innen- und außenpolitischen Bereichen stammen, fehle schlichtweg die Kulturpolitik.
10.09.2021 15:19:48 [Telepolis]
Die Angst vor
Bei ihrer Rede vor dem Deutschen Bundestag hat Angela Merkel für einen Kanzler Armin Laschet geworben und ausdrücklich vor einer Regierungsbeteiligung der Linkspartei gewarnt ("Ich sag ja nur die Wahrheit"). Damit stimmt sie in die Kampagne der Union ein, deren Attacken auf die SPD und die Grünen im Hinblick auf mögliche Koalitionen zunehmen.

Das Kalkül ist klar. Es soll das dunkelrote Angstbild einer linksradikalen, unverlässlichen Partei beschworen werden, die mit ihrer Politik die Stabilität unserer Gesellschaft gefährdet. Olaf Scholz erscheint dabei als Agent eines Linksrucks, der lediglich als Marionette der Parteivorsitzenden Saskia Esken und Norbert Walter-Borjans agiert.

10.09.2021 15:24:40 [Der Freitag]
Bundestagswahl: Wenn Linke träumen könnten
Rechnerisch wäre Rot-Grün-Rot wohl möglich, auch die Wahlprogramme würden das hergeben. Was fehlt? Der Mut zu sozialen und klimagerechten Zukunftsvisionen. Sollte auf dem linken Flügel der SPD jemand zum Träumen neigen, dann sähe das etwa folgendermaßen aus: Eines schönen Tages erscheinen Susanne Hennig-Wellsow und Janine Wissler an der Pforte des Willy-Brandt-Hauses, in der Hand einen verschlossenen Umschlag. Was kann ich für Sie tun?, fragt der Pförtner, und die beiden Linken-Vorsitzenden murmeln gesenkten Hauptes: Wir haben ein Bekenntnis zur NATO mitgebracht. Aha, antwortet der Pförtner, dann legen Sie es doch einfach hier ab.
10.09.2021 17:07:08 [Krass & Konkret]
Deutschland und die Herrschaft der extremen Mitte
Kein anderer Staat als Deutschland eignet sich unter den westlichen Ländern besser dazu, den Begriff der “extremen Mitte” zu veranschaulichen. Hier besteht die politische Macht seit 2005, und dies offiziell, zumeist aus einem Bündnis der beiden herrschenden Kräfte, die als Mitte-links- und Mitte-rechts-Parteien bekannt sind. Der Sozialdemokratischen Partei auf der einen Seite und dem Zusammenschluss aus Christlich-Demokratischer und Christlich-Sozialer Union auf der anderen Seite ist es gelungen, den Anschein zu erwecken, dass das Land von der Mitte aus regiert wird, ganz im Geiste des Kompromisses, der die individuellen Freiheiten garantiert, die sozialen Errungenschaften schützt und den industriellen und finanziellen Kapitalismus einhegt.
11.09.2021 09:37:56 [Verfassungsblog]
Gibt Bayern der Natur Rechte?
„Gib der Natur Rechte!“, fordert ein Volksbegehren in Bayern, das natürliche Eigenrechte in die bayerische Landesverfassung aufnehmen möchte. Bayern wäre mit solchen Rechten nicht allein, denn in den letzten Jahren haben zahlreiche Rechtsordnungen Rechte der Natur anerkannt. Für das deutsche Recht handelt es sich hierbei freilich um eine Neuheit, die jedoch nicht auf unüberwindbare verfassungsrechtliche Hindernisse stoßen dürfte. Im Gegenteil: Für die dringenden ökologischen Fragestellungen unserer Zeit können sich Rechte der Natur als eine wertvolle Chance erweisen.
11.09.2021 12:03:19 [Tichys Einblick]
Besser nicht träumen als schlecht träumen. Das grüne Trauma
Der Staat als Besserungsanstalt, davon träumen Grüne. Haben denn die Leute das pausenlose Wir-haben-nur-eine-Erde-Geflenne nicht endlich satt! Die Grünen wollen ihre Traumtänzerei zum allgemeinen Gesetz erheben. Damit werden sie zum Albtraum. 1983 zogen die Grünen erstmals in den Bundestag. Mit Strickzeug und Grünzeug, das lange Männerblond noch nicht hofreitermäßig über die Krägen dunkler Dreiteiler geföhnt. Ein wilder Haufen von Querdenkern, strotzend vor Selbstverwirklichung. Glühend vor Friedensliebe wie Petra Kelly, ehe ihr Lieblingsgeneral sie erschoss. Die grüne Folklore gründete im Anti. Anti-Atomkraft, Anti-Nachrüstung, Anti-Establishment.
11.09.2021 16:23:29 [Der Freitag]
Afghanistan: Frachtgut Demokratie
Das Scheitern begann für Deutschland gleich nach dem Schock von 9/11. Unterschwellig rumort das Gefühl, in einen Sog der Geschichte zu geraten, dem zu widerstehen ungebührlich ist. Jeder Zwiespalt wäre ein Abgrund – bedingungslose Solidarität mit Amerika heißt der Auftrag. Die rotgrüne Bundesregierung weiß, was die Stunde geschlagen hat, als die USA nach 9/11 erstmals seit Bestehen der NATO den Bündnisfall ausrufen und bald darauf Afghanistan erobern. Der erste Krieg des 21. Jahrhunderts ist zugleich der zweite für die rot-grüne Koalition in Berlin.
11.09.2021 17:32:42 [Junge Welt]
Laschets letzter Trumpf
Auch drei Tage nach dem von Boulevardmedien als »Umfrageschock« bezeichneten Absinken der Unionsparteien unter 20 Prozent versuchen CDU und CSU verzweifelt, den Trend noch umzukehren. Bevorzugtes Rezept: Horrorszenarien für den Fall einer »linken Machtübernahme« bei der Bundestagswahl entwerfen. Zu diesem Zweck zog die Union am Freitag eine Trumpfkarte: das Thema innere und äußere Sicherheit. Union-Kanzlerkandidat Armin Laschet und Verteidigungsministerin Annegret Kramp-Karrenbauer (beide CDU) präsentierten in Berlin ihre »Agenda für ein sicheres Deutschland«.
11.09.2021 17:41:24 [Brave New Europe]
Make Way for Young People
Whereas today, in our completely changed times, forty-year-olds do everything to look like thirty-year-olds and sixty-year-olds like forty-year-olds, whereas today youthfulness, energy, drive, and self-confidence are promoted and recommended, in that past age of security anyone who wanted to get ahead had to try every conceivable means of masking himself in order to appear older. Newspapers recommended means to accelerate the growth of beards; young doctors of twenty-four or twenty-five who had just passed their medical examinations wore mighty beards and put on golden spectacles, even if their eyes did not need them, just so that they could give the impression of ‘experience’ to their first patients.
12.09.2021 07:05:55 [Post von Horn]
CSU: Mit Söder bergab
Wie immer die Bundestagswahl ausgeht: Ein Verlierer steht schon heute fest: die CSU. Sie befindet sich seit 2014 auf einem steilen Abstieg. Bei der Bundestagswahl 2021 wird sie einen neuen Tiefpunkt erreichen. In der Partei wächst die Einsicht, dass die Partei den Niedergang ihrem Vorsitzenden Söder verdankt. Auf dem jüngsten CSU-Parteitag zwei Wochen vor der Bundestagswahl verpasste die Funktionärselite ihrem Vormann einen Dämpfer. Söder bekam bei seiner Wiederwahl zum Vorsitzenden nur 87,6 Prozent, 3,7 Prozentpunkte weniger als vor zwei Jahren.

Verstärkt wird das Signal durch das Ergebnis, das sein Antipode Weber als Vize-Parteichef erzielte.

12.09.2021 07:12:10 [Novo Argumente]
„Politik ist kein Lieferservice“
Dirk Neubauer ist seit Oktober 2013 Bürgermeister der sächsischen Stadt Augustusburg. Bei der letzten Wahl wurde er mit 68 Prozent der Stimmen im Amt bestätigt. Im Mai 2021 erschien seine Streitschrift „Rettet die Demokratie“. Im gleichen Monat trat er aus seiner Partei, der SPD, aus. In seinem Buch geht es um Politiker, die sich als „Kümmerer“ gerieren und dabei „beinahe jedem alles versprechen“, um bürokratische Entscheidungsprozesse, die bewusst komplex gehalten werden und so jede Eigeninitiative ersticken – und um eine politische Kultur, die den Menschen zutiefst misstraut. Vom „Ursatz des Grundgesetzes“, dass alle Staatsgewalt vom Volke ausgeht, bleibe dagegen wenig übrig.
12.09.2021 15:52:37 [Telepolis]
Allianz gegen den "Drogenkommunismus"
Die Vernetzung der europäischen extremen Rechten schreitet voran – und beschränkt sich nicht mehr bloß auf dem eigenen Kontinent. Vor wenigen Wochen besuchte die stellvertretende AfD-Vorsitzende Beatrix von Storch samt Ehemann Sven den brasilianischen Präsidenten Jair Bolsonaro und dessen Sohn Eduardo. Der Präsidentensohn ließ verlautbaren, man teile Ideale wie "Familienverteidigung", "Grenzschutz" sowie der "nationalen Kultur".

Ein gutes Stück weiter nördlich – in Mexiko – erhielten 15 Senatoren der konservativen Partido Acción Nacional (PAN) am 2. September Besuch von der ultrarechten Vox-Partei.

12.09.2021 17:16:53 [Tichys Einblick]
Kreuzberger Plakatkampagne
Die Grünen werben bundesweit mit der Forderung nach sauberer Umwelt, Vielfalt und Gerechtigkeit. Sie inszenieren sich selbst als die Zukunftspartei schlechthin – progressiv, jung und bereit für den Aufbruch. Was die schönen Floskeln und Wahlversprechen in Wahrheit bedeuten und wie die Grünen sich unser aller Zukunft wirklich vorstellen, hat das Kreuzberger Wahlkampfteam jetzt visualisiert und in Farbe gesetzt. Das neue „Kunstplakat“ zeigt unverhohlen, wie man sich gelebte Vielfalt vorstellt: Ein fröhliches Miteinander aus Migranten, LGBTQ, Ökos auf Lastenfahrrädern, queeren Antifa-Aktivisten, dem Hund, der Katze und sogar dem Igel. Nur einer darf nicht mitspielen: der Normalbürger.
12.09.2021 18:38:38 [Thomas Schmid]
Dieser Wahlkampf ist eine Unverschämtheit
Jede politische Wahl ist ein Unikat. Die Abstimmung am 26. September wird es jedoch in einem ganz besonderen Maße sein. Noch nie in der Geschichte der Bundesrepublik war der Ausgang einer Wahl zwei Wochen vor dem Urnengang so offen wie dieses Mal. Das stellt den vorläufigen Höhepunkt einer Entwicklung dar, die schon bald in Gang kam, nachdem Angela Merkel 2005 Bundeskanzlerin geworden war: Die beiden bisher großen Parteien – erst die SPD, dann die Union – verloren ihre milieuübergreifende Bindekraft. Sie sind nun Wettbewerber, die sich nicht mehr fundamental von den kleineren Parteien abheben. Größe ist relativ und das Feld eng geworden.
13.09.2021 07:10:25 [Die Kolumnisten]
Fatale Fehler
Über Fehler und Fehlurteile. Wo Menschen arbeiten, geschehen Fehler. Das ist auch nicht anders, wenn diese Menschen in der Justiz arbeiten und Richter heißen. Nicht jeder dieser Fehler führt zwingend zu einem falschen rechtskräftigen Urteil, da mancher Fehler auf dem Rechtsweg wieder korrigiert werden kann. Mancher, aber leider nicht jeder. Das Ergebnis der anderen Fehler sind Fehlurteile.

Im Zivilrecht kann das schon einmal bedeuten, dass jemand finanziell ruiniert wird, was schlimm genug ist, im Strafrecht ist ein Fehlurteil zu Gunsten des Angeklagten schlecht, weil eine Straftat ungesühnt bleibt, zu Lasten des Angeklagten ist es eine Katastrophe.

13.09.2021 09:25:54 [Zeit Online]
Niedersachsen: SPD und CDU verlieren Stimmen bei Kommunalwahlen
Bei den Kommunalwahlen in Niedersachsen zeichnen sich für die Grünen klare Stimmzuwächse ab. Bei den Direktwahlen kamen in etlichen Kommunen grüne Kandidaten in die Stichwahl. Außerdem verzeichnete eine Erhebung von Infratest dimap für den NDR deutliche Zuwächse bei Grünen und kleinere Gewinne bei der FDP.

CDU und SPD lieferten sich demnach zwei Wochen vor der Bundestagswahl im zweitgrößten Flächenland ein Kopf-an-Kopf-Rennen. Nach der Erhebung, die auf Zwischenständen basiert und daher keine klassische Hochrechnung ist, könnte die CDU bei den Kommunalwahlen unter dem Strich auf 32 Prozent kommen, das wären 2,3 Prozentpunkte weniger als 2016.

13.09.2021 12:02:43 [Novo Argumente]
Wahlkampf: Gewinnt die SPD?
Hat es in der Bundesrepublik vor einer Wahl je so viel Unsicherheit und Orientierungslosigkeit gegeben wie dieses Mal? Die Umfragen sehen – wer hätte das vor wenigen Wochen noch geglaubt – die SPD vorne. Diejenigen – zu denen auch ich gehöre – die noch im Frühjahr von dem langsamen Sterben der Partei sprachen, scheinen sich gründlich geirrt zu haben. Aber, was hat sich in der Partei, die noch im April bei nur 15 Prozent vor sich hindümpelte, seither geändert? Hat sie neue Einsichten gewonnen oder neue Inhalte für sich entdeckt? Wohl kaum! Die SPD ist die gleiche geblieben.
13.09.2021 13:34:15 [Tichys Einblick]
Triell: Drei Kandidaten-Kandidaten – und keiner kann es
Die eigentliche Botschaft der Redeschlacht der drei Kanzlerkandidaten, diesmal im staatlichen Fernsehen von ARD und ZDF, lautet: Keiner der drei Kandidaten hat das Zeug zum Kanzler. Dabei geht es nicht nur um Inhalte, sondern um die Kunst des Regierens. Über Inhalte lässt sich streiten – und wer in der politischen Diskussion Recht hat, zeigt sich sehr oft leider erst, wenn es längst zu spät ist. Die Geschichte ist der unbarmherzige Richter, nicht die eigene Befindlichkeit. Beim Triell zeigte sich: Keiner Kandidaten hat das Zeug dazu, dass man beruhigt aus dem Wahlabend geht. Wer immer es wird, es wird schlimm werden für Deutschland. Übrigens ist erst Kanzlerkandidat, wer im neuen Bundestag vorgeschlagen wird. Und das muss keiner der bisher genannten sein. Und der Wähler kann keinen wählen.
13.09.2021 13:39:57 [Der Freitag]
Seid doch mal ehrlich
Rot-Grün-Rot: Wer sozialökologisch regieren will, darf sich nichts vormachen: Um die Krisen unserer Zeit zu lösen, muss man es mit "dem Kapital" aufnehmen. Und das wehrt sich. Ob die Rote-Socken-Kampagne, mit der die Union alte antikommunistische Reflexe bedient, am Wahlergebnis etwas ändert, sei einmal dahin gestellt. Interessant an ihr ist sowieso etwas Anderes: Die Stimmungsmache vor der Wahl ist nur ein laues Lüftchen verglichen mit dem, was wir zu erwarten hätten, würde nach der Wahl doch noch jemand eine linke Reformagenda ernsthaft in Angriff nehmen. Der dann zu erwartende Sturm ist es, der das Zustandekommen einer linken Reformregierung so unwahrscheinlich macht.
13.09.2021 15:31:09 [WSWS]
Wie die AfD die Diktaturpläne des brasilianischen Präsidenten Bolsonaro unterstützt
Die jüngsten Bemühungen Jair Bolsonaros, in Brasilien ein diktatorisches Regime zu errichten, werfen ein neues Licht auf den Besuch, den die stellvertretende AfD-Vorsitzende Beatrix von Storch in diesem Jahr dem brasilianischen Präsidenten abstattete. Von Storch und ihr Mann Sven trafen sich am 21. Juli mit Bolsonaro in dessen Präsidentenpalast. Von Storch machte das Treffen anschließend auf Instagram publik und veröffentlichte ein Bild, auf dem Bolsonaro die beiden freundschaftlich umarmt. Dazu schrieb sie:

Eine eindrucksvolle Begegnung in Brasilien: Ich danke dem brasilianischen Präsidenten für die freundschaftliche Aufnahme und bin beeindruckt von seinem klaren Verständnis für die Probleme in Europa und die politischen Herausforderungen unserer Zeit.

13.09.2021 15:51:18 [NachDenkSeiten]
Gauck und die „Bekloppten“: Die Verrohung der Kommunikation
Ex-Bundespräsident Joachim Gauck hat einen großen Teil der Bürger als „Bekloppte“ bezeichnet, weil sie andere Auffassungen vertreten als er. Was früher breite Entrüstung ausgelöst hätte, erscheint inzwischen fast normal. Diese Gewöhnung an eine sprachlich-politische Verrohung ist gefährlich. Am Samstag sagte Gauck in Rostock mit Bezug auf den Teil der Bürger, der zögert, sich die neuen Corona-Impfstoffe injizieren zu lassen:

„Dann ist ja auch schrecklich, dass wir in einem Land leben, in dem nicht nur Bildungswillige leben, sondern auch hinreichende Zahlen von Bekloppten.“

13.09.2021 17:26:41 [Verfassungsblog]
Grüne Plakate
Zur straf- und verfassungsrechtlichen Einordnung von verhetzenden Wahlplakaten. In der vergangenen Woche sorgte eine Entscheidung der Staatsanwaltschaft Zwickau für öffentliche Empörung. Der Fall ist paradigmatisch für zentrale Defizite bei der strafrechtlichen Bekämpfung von Hasskriminalität. Es ging um Wahlplakate einer rechtsextremistischen Kleinstpartei, auf denen „Hängt die Grünen!“ abgedruckt war. Abgesetzt unter der Kapitale ist in sehr viel kleinerer Schrift zu lesen: „Macht unsere nationalrevolutionäre Bewegung durch Plakatwerbung in unseren Parteifarben in Stadt und Land bekannt!“. Das Plakat ist in grün gehalten.
14.09.2021 06:32:11 [Post von Horn]
Scholz: Wie ein Rosstäuscher
In der Ära der CDU-Kanzlerin Merkel ist die SPD abgestürzt. Sie fiel von 34,2 Prozent im September 2005 auf 13 Prozent im April 2021. Heute steht sie bei 25 Prozent. Wer glaubt, sie sei erholt, täuscht sich: Aus Mangel an eigener Substanz imitiert sie die Merkel-CDU. Führende SPD-Politiker haben mit kapitalen Fehlern zu kämpfen, vorneweg ihr Kanzlerkandidat Scholz. Ihm hängen drei Skandale an, die Deutschlands Ansehen beschädigt haben. Im Cum-Ex-Steuerskandal unterließ es der damalige Hamburger Bürgermeister Scholz, darauf zu dringen, dass eine Hamburger Bank Steuern in zweistelliger Millionenhöhe nachzahlen musste, um die sie den Staat betrogen hatte.
14.09.2021 11:26:20 [Ansage!]
Wird die Bundestagswahl manipuliert werden?
Dem aufmerksamen Beobachter fällt zwei Wochen vor der anstehenden Bundestagswahl auf, daß ein bestimmtes Thema so gut wie nicht vorkommt in den Medien. Ständig werden Trendbarometer veröffentlicht, es wird spekuliert, ob Rot-Rot-Grün kommt, ob die Union mit Söder als Kanzlerkandidaten besser gefahren wäre usw.usf. – aber gerade dann, wenn es ein sehr aktuelles Thema wäre, liest man nichts über die Möglichkeit einer Wahlmanipulation. Wie´s wohl kommt?

Es ist nicht so, daß Wahlmanipulation kein Thema gewesen wäre. 2017 war es eines, sogar in der „Zeit“. Auch die entsprechende Schlagzeile war eindeutig: „Die Bundestagswahl kann manipuliert werden„.

14.09.2021 13:14:45 [Anti-Spiegel]
Wie der Westen sich in die russischen Parlamentswahlen einmischt
Der Sinn von Wahlen ist, dass die Bevölkerung eines Landes über den politischen, wirtschaftlichen und gesellschaftlichen Kurs ihres eigenen Landes entscheidet. Wenn andere Staaten sich in die Wahlen eines Landes einmischen, dann nicht, weil sie möchten, dass es dem Land besser geht, sondern weil sie ihre eigenen wirtschaftlichen und politischen Interessen durchsetzen wollen. Die westlichen Medien berufen sich bei Wahlen in Russland und Weißrussland gerne auf die NGO Golos, die regelmäßig Berichte über angebliche Wahlfälschungen bringt, die in der westlichen Presse als Tatsachen dargestellt werden.
14.09.2021 14:39:34 [Der Freitag]
Dortmunder Jung
Porträt: Er trägt eine Krawatte, könnte man meinen, doch aus der Nähe zeigt sich: Sie ist aufgedruckt, in Rot, sie ziert sein hellblaues T-Shirt. Früher Freitagabend in Dortmunds Innenstadt, Marco Bülow verteilt Werbeartikel, mit seinem Genossen Martin Sonneborn. Eine Band spielt, die Stimmung ist gelöst, stehen bleiben vor allem junge Menschen. Hier feiert die PARTEI den Auftakt ihrer Wahlkampftour, in der Stadt, die lange als „Herzkammer“ der Sozialdemokratie galt, wofür Bülow seit 2002 ja der lebende Beweis war: Wahl um Wahl hat er in seiner Heimat das Direktmandat geholt und ist dann als Mitglied der SPD-Fraktion in den Bundestag eingezogen. Das ist vorbei.
14.09.2021 14:41:07 [Tichys Einblick]
Der Mehrheitsbeschaffer — Lindners Offerte für Rotgrüngelb
Gestern Abend diskutierten die Vertreter von AfD, CSU, FDP und Linke (Reihenfolge nach dem noch unpolitischen Alphabet) in der ARD in der Sendung „Vierkampf“. Moderiert wurde die Diskussion von den Chefredakteuren des WDR und des BR, Ellen Ehni und Christian Nitsche, die in der Sendung einen der Gründe für den Verlust an Qualität und Pluralismus im öffentlich-rechtlichen Fernsehen offenbarten. Denn so ganz genau wussten die Redakteure nicht, wozu sie gebeten worden waren, dafür die Vertreter der Parteien umso besser.
15.09.2021 07:17:48 [Neues Deutschland]
Spin-Doctoren: Seilschaften der Realos
Die Spitze der Grünen hat Michael Scharfschwerdt für den Wahlkampf engagiert. Er ist Unternehmensberater und hat bereits für Joschka Fischer gearbeitet. Der Höhenflug der Kanzlerkandidatin der Grünen, Annalena Baerbock, scheint erst einmal vorbei zu sein. In den Umfragen liegt ihre Partei mittlerweile hinter der Union und der SPD. Zudem rangieren der Sozialdemokrat Olaf Scholz und der CDU-Vorsitzende Armin Laschet in den jüngsten Erhebungen meist vor Baerbock. Spitzenvertreter der Grünen haben in den vergangenen Wochen eingeräumt, dass bisher im Wahlkampf nicht alles ideal gelaufen ist.
15.09.2021 11:59:03 [RT DE]
Kramp-Karrenbauer versorgt engen Vertrauten vor Bundestagswahlen mit sicherem Posten
Wie der "Spiegel" berichtet, soll die Bundesverteidigungsministerin Annegret Kramp-Karrenbauer mit einer Personalentscheidung kurz vor den Bundestagswahlen für Gegenwind aus der Opposition gesorgt haben. Demnach soll Kramp-Karrenbauer "ihrem engsten politischen Vertrauten Nico Lange in der ersten Septemberwoche durch die Entfristung seines Arbeitsvertrags eine permanente Position im Ministerium gesichert haben", wie der "Spiegel" schreibt. Lange war seit 2012 bis zum Jahr 2017 in Leitungspositionen für die Konrad-Adenauer-Stiftung, anschließend in der Saarländischen Staatskanzlei sowie in der Parteizentrale der CDU tätig.
15.09.2021 12:12:27 [Der Freitag]
Vernebelte Glaskugel
Demoskopie: Wahlumfragen haben ein verheimlichtes Genauigkeitsproblem. Ein Plädoyer für mehr Transparenz: SPD im Aufwind, CDU verliert an Boden? Kurz vor der Wahl alarmieren Umfragen wieder einmal Politik und Wahlvolk. Gewiss sprechen solche Zahlen für etwas. Doch sollte die Kirche im Dorf bleiben: Anteilswerte sind in Umfragen mit freiwilliger Teilnahme fast nie verlässlich zu ermitteln. Und auch auf die angegebenen Unsicherheitsbereiche ist kaum Verlass. Zwar lässt sich in Methoden-Berichten der Wahlforschung Kleingedrucktes zu den Prozenten lesen. Doch eine Schlüsselfrage bleibt offen: Wie groß ist der Anteil der Personen in einer Stichprobe, die tatsächlich ein Interview beantworten?
15.09.2021 13:54:28 [Telepolis]
Baerbocks Welt: Klimaneutralität unbedingt, aber nur mit der Nato
Die Grünen-Kanzlerkandidatin Annalena Baerbock hat klargestellt, dass ihr effektiver Klimaschutz zwar unheimlich wichtig ist, aber im Ernstfall daran scheitern soll, dass die einzige Bundestagspartei, die ihn unterstützen würde, nicht auch militärisch "Verantwortung in der Welt" übernehmen will. Gespräche zwischen demokratischen Parteien auszuschließen, halte sie zwar für falsch, sagte sie der "Süddeutschen Zeitung" vom Dienstag.

"Aber wenn man außenpolitische Handlungsfähigkeit einer Regierung nicht sicherstellen kann, gibt es keine Regierungsgrundlage", befand sie und erteilte damit einer "rot-grün-roten" Koalition nach der Bundestagswahl am 26. September eine Absage, falls die Partei Die Linke ihre Haltung zu Nato-Militäreinsätzen nicht ändert.

15.09.2021 15:34:22 [Telepolis]
Die demokratische Wahl als Triebfeder für Staat, Standort und Nation
Wie Kandidaten um Sympathie, Glaubwürdigkeit und Vertrauen werben und was das Kreuz alle vier Jahre bringt (Teil 1): Kein Zweifel, der Standort Deutschland, die gesamte Nation, befindet sich in der "heißen" Phase des Wahlkampfes: Kein Fußgänger, kein Rad- oder Autofahrer, kein ÖPNV- oder Bahnkunde soll an der Plakatflut, die sich seit Wochen in die Aufmerksamkeit aller und überall ergießt und hineindrängt, vorbeikommen.

Ob Wahlberechtigter oder auch nicht: Eine Politisierung der besonderen Art hat den öffentlichen Raum überschwemmt und in Besitz genommen.

15.09.2021 17:03:30 [Verfassungsblog]
Dürfen Briefwähler von Umfrageinstituten berücksichtigt werden?
Spätestens seit dem vorgestrigen Kanzler-Triell ist der Bundestagswahlkampf in sein Finale eingetreten – und zeigt eindrücklich, dass Politik ebenso spannend wie unberechenbar sei kann. Wie die stetig schwankenden Ergebnisse der Meinungsumfragen aus den letzten Wochen illustrieren, dürfte die Kräfteverteilung im 20. Deutschen Bundestag bis zum 26. September 2021 weitgehend unvorhersehbar bleiben. Ob man die Demoskopie mit Markus Söder als „wichtigen Maßstab“ oder mit Armin Laschet als „nicht entscheidend“ apostrophiert, ist eine Glaubensfrage; nicht zu bezweifeln ist jedenfalls, dass Meinungsumfragen trotz ihres Charakters als Momentaufnahme eine wichtige Handlungs- und Entscheidungsgrundlage für Bürger sowie Wahlbewerber sind.
15.09.2021 17:05:28 [Jacobin]
Die Ampel steht auf Gelb
Grüne und SPD wollen regieren. Während sie sich zur Linkspartei abgrenzen, fassen sie die FDP mit Samthandschuhen an. Das ist gefährlich. Nachdem eine schwarz-grüne Koalition lange als das einzige realistische Szenario gehandelt wurde, hat sich das Blatt nun wenige Wochen vor der Wahl gewendet: Deutschland-Koalition, Ampel, Jamaika oder Rot-Rot-Grün – sämtliche Koalitionsoptionen sind im Gespräch. Viele Linke hatten die Hoffnung auf ein rot-rot-grünes Bündnis schon aufgegeben, mittlerweile ist es in den Fokus öffentlicher Debatten gerückt – leider vor allem in Form einer Rote-Socken-Kampagne von rechts.
15.09.2021 17:28:43 [Blätter]
Das Erbe der Merkel-Ära: Aus Krise wird Katastrophe
Dramatischer könnten die Vorzeichen kaum sein, unter denen am 26. September die Bundestagswahl stattfindet und zugleich die politische Ära Angela Merkels endet. Hatten die meisten Beobachter noch vor kurzem angenommen, die bald eineinhalb Jahre dauernde Coronakrise werde im Mittelpunkt des Wahlkampfs stehen, haben uns die vergangenen Wochen und Monate eines Schlechteren belehrt. Erst kam die dramatische Sturzflut in Nordrhein-Westfalen und Rheinland-Pfalz und dann auch noch der Siegeszug der Taliban und das historische Scheitern der Nato-Mission in Afghanistan.
15.09.2021 18:55:13 [Tichys Einblick]
Das Possenspiel Kanzlerkandidaten
Der Erste, der das Possenspiel der Kanzlerkandidaten entlarvte, war das politische Naturtalent Guido Westerwelle. Als es im Jahr 2002 um die Wahlen zum Deutschen Bundestag ging, ließ sich der FDP-Vorsitzende von seinen Delegierten mit fast hundert Prozent Zustimmung zum Kanzlerkandidaten küren. Der damalige Beschluss lautete: „Als Partei für das ganze Volk treten wir mit unserem eigenen Kanzlerkandidaten an. Die FDP will die Bundestagswahl mit Guido Westerwelle zu einem Erfolg für Deutschland machen.“

Medien und Konkurrenz staunten – und konnten sich vor Spott kaum halten.

15.09.2021 19:10:07 [NachDenkSeiten]
Die Wahlen sind wie eine Pralinenschachtel
Früher war die Welt sicher nicht in allen Punkten besser, aber sie war doch deutlich einfacher. Es gab mit der CDU und der SPD zwei klar voneinander zu unterscheidende Parteien, die für grundsätzlich unterschiedliche politische Konzepte standen. Heute würde man wohl sagen, die beiden Volksparteien hatten ihr Alleinstellungsmerkmal und ein dazu passendes Narrativ. Sicher, auch heute gibt es immer noch unterschiedliche politische Konzepte. Aber es gibt keine großen Parteien mehr, die man klar diesen Konzepten zuordnen könnte.
 Topthemen (69)
01.09.2021 06:42:38 [Novo Argumente]
Bürgerrechte unter Vorbehalt
Die Corona-Impfung soll zur Bedingung für die vollumfängliche Gewährung der Bürgerrechte werden. Es geht um weit mehr als nur die Impfpflicht durch die Hintertür.

Wenn es zu „Einschränkungen für Nichtgeimpfte“ komme, so warnte Baden-Württembergs Ministerpräsident Winfried Kretschmann (Grüne) noch vor dem Bund-Länder-Treffen am Dienstag letzter Woche, sei das „die selbstgewählte Konsequenz aus der freien Entscheidung sich nicht impfen zu lassen“. Zwar wurde im Bund-Länder-Treffen vom 10. August vereinbart, dass Geimpfte, Genesene und Getestete formal weiterhin gleichgestellt sind, allerdings werden die praktischen Hürden der Gleichbehandlung hochgeschraubt.

01.09.2021 06:53:12 [Telepolis]
Wer tötete Ahmad Schah Massoud?
Afghanistan jenseits von 9/11. Zwei Tage vor dem 11. September, am 9.9.2001, starb der aussichtsreichste Kandidat auf das Präsidentenamt in einem geeinten Afghanistan, Ahmad Schah Massoud, der Löwe des Pandschschir, Führer der Nordallianz. Fatal, wie die falschen Reaktionen auf 9/11 sich als fatal erwiesen, war es, dieses Faktum zu übersehen. Man wünschte sich angesichts des Desasters in Afghanistan, von den jetzt überraschten Politikern hätte einmal einer am Friedensratschlag in Kassel teilgenommen, dem - vor der Corona-Krise - jährlich stattfindenden Treffen der Friedensbewegung Deutschlands.
01.09.2021 09:10:41 [Radio FM4]
Neuer ETSI-Standard zur Meldung von Sicherheitslücken
Das bisher mehr für die Standardisierung von Hintertüren für Überwachungsbehörden als für IT-Security bekannte europäische Normeninstitut für Telekoms ETSI beschäftigt sich nun mit der Auffindung von nicht-normierten Sicherheitslücken. Die Entdeckung immer neuer, kritischer Sicherheitslücken in IT-Equipment der Industrie hat spät aber doch auch das europäische Normeninstitut für Telekoms (ETSI) aufgeweckt. Noch bis 15. September läuft die öffentliche Begutachtungsfrist für eine ETSI-Spezifikation, die den Meldevorgang von Sicherheitslücken durch Dritte vereinheitlichen soll.
01.09.2021 12:34:26 [Junge Welt]
Presse und Krieg: »Die Vorlagen liefert das Ministerium«
Viele Medien bemühen sich um regierungsfreundliche Inszenierung des Bundeswehr-Einsatzes in Kabul. Ein Gespräch mit Christoph Marischka: In der Berichterstattung zum Thema Afghanistan kommt die Bundeswehr in fast allen Medien erstaunlich gut weg. Ist es nicht ein Stück weit paradox, dass sie vor dem Hintergrund der Evakuierungen plötzlich nur noch als Freund und Helfer dargestellt wird?

Das gilt auch für die Bundesregierung. Wir sollten nicht vergessen, dass sie noch Anfang August Menschen nach Afghanistan abschieben wollte und das zuvor auch jahrelang durchgezogen hat. Plötzlich glauben alle, es sei ihr höchstes Ziel, möglichst viele Menschen aus Afghanistan herauszubringen.

01.09.2021 14:27:51 [NachDenkSeiten]
„Das offen zu sagen, wagt kaum jemand“
Politiker halten Sonntagsreden, doch die Kinderarmut ist eine Realität in Deutschland und die Ungleichheit, basierend auf den finanziellen Möglichkeiten, ist „Gift für den gesellschaftlichen Zusammenhalt“. Das sagt der Armutsforscher Christoph Butterwegge im Interview mit den NachDenkSeiten. Mit deutlichen Worten zeigt der Politikwissenschaftler auf, was es bedeutet, wenn arme und reiche Kinder in einer Gesellschaft existieren: „Nie war eine junge Generation zerrissener als die heutige.“ Auf der anderen Seite, so führt Butterwegge aus, steht das, was man als „Kinderreichtum“ bezeichnen kann: „90 Kinder unter 14 Jahren bekamen zwischen 2011 und 2014 im Durchschnitt je 327 Millionen Euro geschenkt. Steuerfrei, wohlgemerkt.“
01.09.2021 19:11:09 [Brave New Europe]
EU Commission and platform worker regulation
In a Gig Economy Project exclusive, we reveal the lobbying influence of digital labour platforms over the Commission’s plans for regulating platform work. The European Commission (EC) has been lobbied 10 times this year by platform companies over its plans to develop regulation on the working conditions of platform workers, while holding no meetings with trade unions or other groups representative of platform workers, the Gig Economy Project (GEP) can reveal.

On 24 February, the Commission announced a consultation on regulating platform work, the first phase of which ended in April and concluded “that there is a need for EU action to address these issues”.

01.09.2021 19:33:20 [Egon W. Kreutzer]
Die Form der Freiheit
Markus Söder hat für Bayern Veränderungen im Corona-Regime angekündigt. Im Freien soll grundsätzlich alles erlaubt sein, in Innenräumen soll grundsätzlich 3 G herrschen. Dazu eine neue Ampel, die anzeigt, in welchem Maße die Krankenhäuser mit Covid-Patienten belegt sind, was bei Überschreiten der Grenzwerte zur Verschärfung von Maßnahmen führen wird. Diese Veränderungen sind es nicht, die mich zu diesem Artikel bewogen haben. Es ist der von Söder benutzte Neusprech-Begriff "die neue Form der Freiheit", der mich ganz erheblich stört. Der Freiheit eine neue Form zu geben, das heißt doch, zunächst einmal, der Freiheit ihr Wesen zu nehmen und sie gewaltsam in eine formbare Masse zu verwandeln.

06.09.2021 06:43:03 [Axel B.C. Krauss]
Die finanzielle Übernahme & Ihr Bankkonto
Haben Sie schon einmal von Yodlee gehört? Ich auch nicht, bis ich entdeckte, dass das Unternehmen meine Daten in meinem Bankkonto sammelt und sie wahrscheinlich an Dritte verkauft. Dies wurde schnell zu einer persönlichen Recherche, bis ich erschütternde Zusammenhänge entdeckte, von denen ich erkannte, dass die Öffentlichkeit darauf aufmerksam gemacht werden muss. Bevor Sie beschließen, dass dies nichts mit Ihnen zu tun hätte, bitte ich Sie dringend, diesen Artikel in seiner Gesamtheit zu lesen und die zeitlichen Abläufe genau zu beachten, denn dies betrifft SIE ALLE, und es wird in mehreren Ländern eingeführt.
06.09.2021 09:27:15 [Anderwelt Online]
Gesundheitsminister Spahn bestätigt: Es ist eine Testpandemie
Der Bankkaufmann Spahn ist schon öfter aufgefallen durch unbedachte Aussagen, die entlarvend sind. So hat er schon im Frühsommer 2020 angekündigt, dass er und seine Spießgesellen wohl für Diverses um Verzeihung werden bitten müssen. Jetzt hat er bestätigt, dass es keine Corona-, sondern eine Testpandemie ist.

Obwohl keine der „Talkrunden“ im ÖRR Livesendungen sind, ist es kaum durchführbar, Aussagen herauszuschneiden, die mehr als unliebsam sind. Das würde auffallen. Da müsste dann die gesamte Sendung gestrichen werden. Ob sich das Herr Spahn auch wünschen würde, nach dem, was er am 30.08.2021 bei „Hart aber fair“ abgelassen hat?

06.09.2021 11:39:55 [Apolut]
Löst diese NATO auf!
Wir sind eigentlich seit dem völkererechtswidrigen und ordinären Angriffskrieg der NATO gegen die Bundesrepublik Jugoslawien im Frühjahr 1999 gewarnt. Wenn die Vereinigten Staaten Krieg für ihre Interessen führen wollen, dann interessiert weder der NATO-Vertrag noch die Charta der Vereinten Nationen mit der Ächtung des Krieges. Dannn werden Selbstermächtigungen gefaßt und die entsprechenden Texte den sogenannten Verbündeten zwecks Beschlussfassung vorgelegt. Das war vor dem Jugoslawien-Krieg nicht anders, weil der NATO-Vertrag und die Charta der Vereinten Nationen als einzige völkerrechtlich verbindliche Grundlage für den NATO-Vertrag nicht anders, weil beide keine Kriegsermächtigung hergaben.
06.09.2021 13:41:00 [German Foreign Policy]
EU-Kriegskoalitionen der Willigen
Berlin und Brüssel suchen die Niederlage des Westens in Afghanistan zum forcierten Aufbau einer neuen EU-Eingreiftruppe zu nutzen. Man habe gegen die US-Entscheidung zum Abzug vom Hindukusch "kaum Widerstand" geleistet, weil man nicht über ausreichende eigene militärische "Fähigkeiten" verfüge, moniert Bundesverteidigungsministerin Annegret Kramp-Karrenbauer. Man könne nur "gewinnen", wenn die EU stärker werde sowie "auf Augenhöhe mit den USA" gelange. Bereits zuvor hatte der EU-Außenbeauftragte Josep Borrell in einem Medienbeitrag gefordert, neben "militärischen Schlüsselfähigkeiten" müsse die Union vor allem eine besonders schlagkräftige Eingreiftruppe ("initial entry force") aufbauen.
06.09.2021 17:30:34 [M 7]
Grüne: Klimawandel und Imperialismus-Doktrin
Ein Denkfehler scheint das Gros der politischen Betrachter nicht zu kümmern. Wenn davon ausgegangen wird, dass der Klimawandel eine die Menschheit bedrohende Erscheinung ist, dann kann sie auch nur in einer gemeinsamen, den Globus umfassenden Anstrengung angegangen werden. Während im nationalen Fokus davon ausgegangen wird, was alles getan werden muss, um das beschriebene Phänomen in den Griff zu bekommen, angefangen von einem fragwürdigen De-Industrialisierungskonzept bis hin zu einer bis dato nur hypothetischen Energiekonzeption, werden in der Außenpolitik alte Stereotypen bedient, die sich aus einer Konfrontationspolitik speisen, die vor allem aus den Verlustängsten der eigenen Hegemonie seitens der USA gespeist werden.
06.09.2021 17:34:47 [Norbert Häring]
Gates- und Rockefeller-Stiftungen finanzieren WHO-Richtlinien für den digitalen Impfpass
Die Gates-Stiftung und die Rockefeller-Stiftung, die über ID2020 und andere Initiativen Bevölkerungskontrolle mit einer globalen digitalen Bürgernummer anstreben, haben die jüngste Richtlinie der Weltgesundheitsorganisation zum digitalen Impfpass finanziert. Der Rüstungs- und digitale Sicherheitskonzern Thales hatte diesen jüngst als Wegbereiter für den universellen mobil-digitalen Identitätsnachweis bezeichnet.

Die Weltgesundheitsorganisation hat am 27. August eine an die Mitgliedsregierungen gerichtete Richtlinie zur Einführung und technischen Spezifikation von digitalen Impfpässen veröffentlicht.

07.09.2021 07:05:35 [Telepolis]
Was das liberalste Deutschland, das es je gab, alles nicht aushält
Die öffentliche Meinung in Deutschland ist sich weitgehend einig, dass es in dieser Welt indiskutabel repressive und autoritäre "Regime" gibt: Nordkorea und China zählen mit Sicherheit dazu, auch Putins Russland und die Mullahs im Iran.

Und wenn man auch nicht so sehr viel weiß über diese Länder, ist man sich sicher: In diesen Ländern wird die Meinungs- und Pressefreiheit mit Füßen getreten, es herrschen Zensur und allgegenwärtige staatliche Überwachung, Proteste und Demonstrationen, so es sie überhaupt gibt, werden niedergeschlagen, Teilnehmer und Aktivisten mit übelsten Polizeistaat-Methoden behandelt.

07.09.2021 11:33:12 [NachDenkSeiten]
Gegen die innere und äußere Ausgangssperre
Als mir ein Freund erzählte, dass er nach 22 Uhr auf einer Parkbank saß und dort sitzen blieb, als sich mehrere Polizeibeamte vor ihm aufbauten, und für den Verstoß von Corona-Verordnungen ein Bußgeld von 200 Euro als Quittung bekam, packte mich erst große Wut und dann auch ganz viel Ohnmacht. Was soll der Wahnsinn? Hat das irgendeinen Sinn? Oder liegt zum Teil gerade in der Sinnlosigkeit die Macht der ständig wechselnden Verordnungen und Maßregelungen? Auf der Suche nach Erklärungen habe ich den Philosophen, Historiker, Soziologen und Psychologen Michel Foucault ausgegraben, der in den 1970er Jahren zu Disziplinarmächten und Disziplinargesellschaften geforscht und geschrieben hatte … und war erstaunt und erschrocken zugleich, wie aktuell sein „Werk“ ist. Für einen Freund, der auch für mich auf der Bank sitzen blieb.
07.09.2021 13:35:25 [IMI-Online]
Strategischer Raum Meer: Der Blick von Politik und Militär aufs Wasser
Die politisch gewollte Verschiebung des Einsatzraums dient nur vordergründig der Sicherung der Weltmeere und der Handelsrouten – vielmehr zeigt sich darin ein Konzept, weltweit für „deutsche Interessen“ einzustehen und „Flagge zu zeigen“. Unter dem Aspekt einer Naval Diplomacy[8] betrachtet, einer Diplomatie mithilfe der Marine, baute die Bundeswehr ab 2013 systematisch ein Instrumentarium zur Projektion militärischer Macht und politischer Ansprüche auf. Marineschiffe vor die Küste irgendeines anderen Staates zu schicken, kann dabei eine Vielzahl von Funktionen erfüllen. Bei einer vielleicht sogar positiv zu bewertenden und deeskalierend wirkenden gemeinsamen Übung (z.B. Seenotrettung) oder bei einem Hafenbesuch geht es in erster Linie darum, dass sich Soldaten begegnen und Spannungen abgebaut werden.
07.09.2021 15:31:58 [TauBlog]
Mal wieder nicht zuständig
Ob man die Corona-Regeln beachtet oder nicht, spielt keine Rolle mehr. Eine gewisse Ordnung, die es dafür bräuchte, um den niedergeschriebenen Paragraphen-Irrsinn zu begreifen und umzusetzen, gibt es nicht mehr. Sie existiert allenfalls noch als verklärte Vorstellung längst vergangener Tage. In der Wirklichkeit haben wir es mit einer organisierten Verantwortungslosigkeit zu tun, die hier schon oft thematisiert worden ist. Die Regierung erlässt wohlklingende und scharfe Vorschriften, fühlt sich für deren Umsetzung aber anschließend nicht mehr zuständig.

Neulich wurde die Landesregierung Niedersachsen gefragt, wer denn die 3G-Regeln überprüft.

07.09.2021 16:59:38 [Abgeordnetenwatch]
Hunderttausende Euro von Abgeordneten blieben jahrelang unentdeckt
Seit seinem Einzug in den Bundestag vor vier Jahren verdiente der CSU-Abgeordnete Michael Kuffer mehr als 600.000 Euro nebenher. Rätselhaft ist, warum das erst jetzt sichtbar wird. Als der CSU-Politiker Michael Kuffer im September 2017 erstmals in den Deutschen Bundestag gewählt wurde, gelang ihm dies auch dank einer sorgfältig geplanten Wahlkampagne. "Politik braucht Typen", ließ Kuffer damals in seinem Wahlkreis München-Süd plakatieren und präsentierte sich als "Law and Order Liberaler."

Nach seinem Einzug ins Parlament gab es Ärger. Die renommierte Agentur, die Kuffers Wahlkampagne betreut hatte, blieb jahrelang auf einer Rechnung in fünfstelliger Höhe sitzen – und zog vor Gericht.

07.09.2021 18:46:18 [Neue Zürcher Zeitung]
Das deutsche Bundesverfassungsgericht wird 70 Jahre alt
Vom Gegenspieler der Regierung zu Merkels verlängertem Arm? Zugleich Gericht und Verfassungsorgan, hat «Karlsruhe» das deutsche Recht geprägt. Jüngst wurde die Kritik jedoch immer lauter – man vermisst einen Verteidiger der Freiheit in der Pandemie. Neuerdings hat das Bundesverfassungsgericht einen Instagram-Account – wie ein Influencer. Dort gibt es zwar bis jetzt nur Ansichten seiner Immobilie zu sehen. Ein Influencer war das Gericht in seiner nunmehr 70-jährigen Geschichte aber tatsächlich. Am 7. September 1951 nahm es im baden-württembergischen Karlsruhe seine Arbeit auf. Es hat die Freiheit immer wieder verteidigen und neu vermessen müssen und damit auch die Rechtsentwicklung beeinflusst.
07.09.2021 19:06:47 [Egon W. Kreutzer]
Nur noch 938.000 Beschäftigte in der deutschen Landwirtschaft
Wieviel Strom braucht eine Milchkuh? Wenn nach dem 26. September eine Koalition mit Grünstich auch den Landwirten den Strom abdrehen wird, werden es nicht die dümmsten Kälber in den Kuhställen gewesen sein, die diese Situation herbeigewählt haben. Ein Rundumschlag mit ländlicher Note:
Fast eine Million Beschäftigte in der Landwirtschaft, das ist doch immer noch verdammt viel, oder?

Nun ja, die Zahl entspricht dem soeben veröffentlichten Stand von 2020 und dürfte sich inzwischen schon wieder um rund 16.000 reduziert haben, denn vor elf Jahren, also 2010, bei der letzten Erhebung, waren es noch gut 1,1 Millionen.

08.09.2021 07:11:00 [Telepolis]
Nach Afghanistan: Sicherheit Deutschlands wird fortan weltweit verteidigt
Die letzten Menschen waren noch nicht aus Kabul ausgeflogen, da ergingen sich hierzulande schon Politiker wie Journalisten in der Frage, welche Konsequenzen aus dem Afghanistan-Krieg zu ziehen seien. Zwar wurden überwiegend Schuldfragen gewälzt und viele, die über Jahre den zivilen Charakter dieses Krieges – unsere legendäre Friedensmission in Sachen Brunnenbohren und Schulaufsicht – betont hatten, traten plötzlich als Kritiker eines "sinnlosen", zwar "gut gemeinten", aber auf "Fehleinschätzungen" basierenden Krieges auf.
08.09.2021 09:20:30 [RT DE]
Der medizinisch-industrielle Komplex als Goldesel von Big Pharma
Der medizinisch-industrielle Komplex ist – wie der militärisch-industrielle Komplex – eine Bedrohung für die Demokratie. Die Öffentlichkeit hat erkannt, dass Angst zur Meinungsbildung verwendet wird, um Kriege zu führen und die Kontrolle über die Bürger zu übernehmen. Aber beim medizinisch-industriellen Komplex fällt sie nun auf dieselbe Illusion herein. Zu sehen, wie die Taliban wie GI Joe in ihren neu erbeuteten US-Kampfanzügen durch Kabul paradieren und mit den besten Waffen posieren, die der US-Steuerzahler kaufen konnte, hinterlässt einen bitteren Geschmack im Mund selbst jener, die zu den leidenschaftlichsten Unterstützern ausländischer Militärinterventionen gehören.
08.09.2021 09:49:49 [Police IT]
Fragen an Polizeibehörden zu Big-Data-Analysesystemen von Palantir
Die deutsche Palantir-Tochter hat im Jahr 2019 ihren Umsatz um 133% gegenüber dem Vorjahr gesteigert, auf 28,3 Mio Euro. Damit gehört sie zu den mittelgroßen Kapitalgesellschaften und ist zur Offenlegung eines ausführlichen Jahresabschlusses mit Anhang und Lagebericht verpflichtet. Das geschah offensichtlich nicht fristgemäß, weshalb das Bundesamt für Justiz ein Ordnungsgeldverfahren eingeleitet hatte. Am 24.08.2021 wurde nun im Unternehmensregister ein Jahresabschluss der Palantir Technologies GmbH für 2019 im gesetzlich geforderten Umfang veröffentlicht.
Drei wesentliche Fragen – vor allem aus der Sicht von Polizeibehörden als Kunden bzw. Interessenten von Palantir – ergeben sich aus diesem Jahresabschluss.

08.09.2021 13:53:46 [Brave New Europe]
Washington’s Doomed New Way of Waging War
An ill-judged attempt to find out who is to blame for failing to predict the swift victory of the Taliban and the disintegration of Afghan government forces is masking the most significant strategic lessons of the Afghan war.

Turning points in history usually come by surprise because, if the powers-that-be of the day could see those turning points coming at them, they would take steps to avoid them. Governments and the public like to believe that there is more inevitability in history than there really is. Unexpected events of great significance, such as the fall of France in 1940, the overthrow of the Shah in 1979 and the collapse of the Soviet Union in 1991 were followed by inquiries into why experts did not foresee them.

08.09.2021 17:17:26 [Pro Asyl]
Vergessenes Elend: Ein Jahr nach dem Brand in Moria
Als Moria in der Nacht vom 8. auf den 9. September in Flammen stand und vielen Geflüchteten auch noch die letzten Habseligkeiten nahm, war die verzweifelte Lage der Menschen für ein paar Tage im Bewusstsein der deutschen und europäischen Öffentlichkeit. Die Bilder von Kindern, die auf der Straße unter Planen schlafen mussten, sorgten für den notwendigen Druck auf die politisch Verantwortlichen. Viel wurde versprochen. Wie so oft blieb es aber meist bei warmen Worten.

Bis Ende April 2021 dauerte es, bis auch die letzten der handverlesenen 2.765 Menschen, vornehmlich Familien und Kinder, aus Griechenland nach Deutschland ausgeflogen wurden.

08.09.2021 19:06:05 [Egon W. Kreutzer]
Was ist die AfD?
Als Alexander Gauland vor zwei oder drei Jahren erklärte, seine Partei sei halt „ein gäriger Haufen“, war das vielleicht die zutreffendste Beschreibung, die man seinerzeit für die AfD finden konnte. Betrachtet man die AfD heute, scheint der Gärungsprozess sich verlangsamt zu haben. Es brodelt nicht mehr so stark im Kessel, doch zu Ende ist es noch nicht. Es besteht sogar die Gefahr, dass der „Wein“ nach der vollständigen Vergärung sowohl seine fruchtige Säure als auch die verführerische Süße des einstigen „Federweißen“ verloren haben könnte. Doch noch ist die AfD nicht ganz tot.
09.09.2021 07:27:02 [Telepolis]
Deutsche Fregatte wird auf illegaler US-Basis im Indopazifik betankt
Ungeachtet kritischer Stimmen der Opposition und von Regionalexperten in Deutschland sowie der chinesischen Regierung wird die deutsche Fregatte "Bayern" in diesen Tagen die illegal besetzt gehaltenen US-Militärbasis Diego García im Indischen Ozean anlaufen. Die "Bayern" wird dort vom US-Militär Treibstoff aufzunehmen. Das bestätigte das Marinekommando Telepolis auf Anfrage.

Heikel an der Mission: Das deutsche Militär und die Bundesregierung missachten damit gleich mehrere international gültige Urteile, die eine Rückgabe des Eilands an den Inselstaat Mauritius gefordert haben.

09.09.2021 11:36:19 [Telepolis]
Mit Arbeitsdienst die Wahl gewinnen?
Panik-Initiative der Union: Zweieinhalb Wochen vor der Bundestagswahl haben Unionspolitiker vorgeschlagen, Langzeitarbeitslose zum Arbeitsdienst zu verpflichten. Wer über einen längeren Zeitraum hinweg keine Arbeit habe und von staatlichen Zuwendungen lebe, könne Laub oder Müll im öffentlichen Raum sammeln, hieß es von dieser Seite.

Die konservativen Befürworter einer solchen Initiative verwiesen auf eine entsprechende Initiative in Dänemark. Dort aber ist der Vorschlag umstritten: Kritik kommt nicht nur von der politischen Linken, sondern auch von den Kommunen, in denen die Arbeitsprogramme umgesetzt werden müssten.

09.09.2021 13:22:03 [NachDenkSeiten]
Böhmermann und Spiegel gegen Lanz
Die Torwächter der Corona-Meinungsmache. In den letzten Tagen sind verbale Angriffe auf den Talkshow-Moderator Markus Lanz vonseiten des TV-Entertainers Jan Böhmermann und anderen Stellen bekannt geworden. Der Vorgang mag für sich genommen nicht besonders relevant erscheinen – ebenso wie die TV-Figur Böhmermann. Aber die Episode steht stellvertretend für größere Entwicklungen in der deutschen Medienlandschaft, die der Meinungsvielfalt nicht gut tun. Und sie demonstriert das fragwürdige Bild, das Böhmermann und auch etwa Redakteure des Spiegel (vor allem seit Corona, aber bereits zuvor) von sich selber angefertigt haben und welche Rolle von Meinungs-Torwächtern sie sich anmaßen.
09.09.2021 15:30:57 [German Foreign Policy]
„Eine gewisse Doppelmoral“: Fregatte Bayern auf Asien-Pazifik-Fahrt
Der geplante Aufenthalt der Fregatte Bayern auf dem völkerrechtswidrig in britischer Herrschaft gehaltenen US-Militärstützpunkt Diego Garcia stößt in zunehmendem Maß auf Kritik. Die Insel mitten im Indischen Ozean ist Teil des Chagos-Archipels, den Großbritannien im Verlauf der Entkolonialisierung einst völkerrechtswidrig seiner Kolonie Mauritius entrissen hat, um den USA den Bau des Militärstützpunkts zu ermöglichen. Mittlerweile haben mehrere UN-Gerichte die Rückgabe des Archipels verlangt. Indem die Fregatte Bayern im Rahmen ihrer Asien-Pazifik-Fahrt dort in Kürze anlege, akzeptiere sie "de facto" den Rechtsbruch, warnt ein Experte der Stiftung Wissenschaft und Politik (SWP).
09.09.2021 17:03:28 [Norbert Häring]
Solidaritätsaufruf: Wozu haben wir uns impfen lassen, wenn wir weiter Angst vor Ungeimpften haben sollen?
Wir Geimpften sind gegen schwere Verläufe einer Corona-Infektion sehr gut geschützt, wird uns versichert. Deshalb haben wir uns impfen lassen. Trotzdem denken sich die Politiker immer neue Arten der Ausgrenzung für Ungeimpfte aus, um diese von uns fern zu halten. Ich rufe alle Geimpften auf, dieses üble Spiel, das die Gesellschaft spaltet, nicht mitzumachen.

Entweder die Impfung schützt, dann brauchen wir keine Angst vor Ungeimpften zu haben, oder sie schützt nicht, dann hat man uns betrogen. Leute wie Jens Spahn und Karl Lauterbach, die dafür eintreten, Menschen, die sich nicht Impfen lassen wollen, per 2G weitgehend vom öffentlichen Leben auszuschließen.

09.09.2021 18:44:02 [SoZ - Sozialistische Zeitung]
Monumentales Systemversagen
Die Flutkatastrophe bringt es an den Tag: Der neoliberale Staat scheitert beim Schutz der Bevölkerung. «Tief Mitteleuropa» nennen Meteorologen die Großwetterlage, die Mitte Juli über Deutschland binnen 24 Stunden bis zu 200 Liter Regen pro Quadratmeter ausgeschüttet hat. 220 Menschen sind in Deutschland und Belgien in den Fluten um ihr Leben gekommen. Die Wassermassen haben einen Sachschaden von mehreren Milliarden Euro hinterlassen.

Im steilen Ahrtal, wo sich von Westen kommende Wolken oft zum ersten Mal entleeren, in dessen Schiefergestein Starkregen kaum versickert und auf steilen Weinbergen ungebremst talwärts rauscht, haben die Bachbegradigungen der 70er Jahre noch ein übriges getan, um die Situation zu verschlimmern.

09.09.2021 19:08:01 [Egon W. Kreutzer]
Mit Speck fängt man Mäuse – die Impfversuchung
Im heutigen Artikel geht es darum, die aus der Werbung entlehnten Strategien zur Steigerung der Impfbereitschaft der Bevölkerung offen zu legen und aufzuzeigen, dass die Zeit der verführerischen Werbung zu Ende ist und stattdessen die Daumenschrauben angezogen werden, ganz nach dem Motto: Und bist du nicht willig, so brauch ich Gewalt. Am Ende frage ich, wozu der ganze Aufwand? Man muss vielleicht damit beginnen, dass schon der Begriff „ungeimpft“ ein Framing ist. Verlässt man dieses Framing und richtet den Fokus auf sich selbst, dann wird aus „ungeimpft“ erst einmal „gesund“. Das ist ein himmelweiter Unterschied, denn „ungeimpft“ suggeriert ein extremes Risiko.

10.09.2021 09:57:20 [Brave New Europe]
Trade unions in facilitating workplace change
Trade unionism has had different trajectories across the world depending on the historical, economic and political national systems in which it is embedded. Despite the diversity of trade unions’ movements, one clear trend has been visible for the last four decades across many countries. Union membership has dropped significantly and trade unions ‘now operate in far harsher economic and political environments’ if compared to the golden age of the post-war era. As the influence of trade unions declined, collective bargaining came to be seen as ‘a failing mechanism for improving labour standards.’ If the power of traditional worker’s organising seems to have waned, income inequality and labour injustices have not.
10.09.2021 11:28:17 [Junge Welt]
Krieg in Jemen: IWF mischt mit
Die von großen Teilen der »internationalen Gemeinschaft« anerkannte, demokratisch aber schon seit sechs Jahren nicht mehr legitimierte jemenitische »Regierung« von Abed Rabbo Mansur Hadi hat am 23. August Reserven im Wert von 665 Millionen US-Dollar vom Internationalen Währungsfonds (IWF) zugesprochen. Dabei handelt es sich um die Zuteilung des sogenannten Sonderziehungsrechts (SZR), der durch US-Dollar, Euro, Yen, Pfund Sterling und Yuan gesicherten Tauscheinheit des Fonds. »Die SZR-Zuteilung wird die jemenitischen Devisenreserven um über 70 Prozent erhöhen und die dringend benötigte Unterstützung bei der Bewältigung der Krise bieten, einschließlich der vielen dringenden Nahrungsmittel- und medizinischen Bedürfnisse der Bevölkerung«, erklärte der IWF-Regionalvertreter Gazi Shbaikat gegenüber Reuters.
10.09.2021 13:28:43 [Jacobin]
Die beste Konservative, die die SPD je hatte
Franziska Giffey will Berlins Bürgermeisterin werden. Dabei verkörpert sie alles, was in der SPD seit Jahren falsch läuft. In einem wohl beispiellosen Vorgang haben sich die Grüne Jugend und die Linksjugend am 24. August 2021 zusammengeschlossen, um in einem gemeinsamen Schreiben den Rücktritt von Franziska Giffey als Spitzenkandidatin der Berliner SPD zu fordern. Sie setzen alles daran, nach der Wahl zum Abgeordnetenhaus die rot-rot-grüne Koalition fortsetzen zu können. Dieses Regierungsbündnis erzielt in Umfragen seit Jahren stabile Mehrheiten in der Bundeshauptstadt.
10.09.2021 17:10:58 [ScienceFiles]
Weltweit orchestrierte Kampagne: “Pandemie der Ungeimpften”
International gibt es immerhin ein paar Beiträge, die die “Pandemie der Ungeimpften”, jenen orchestrierten Blödsinn, den Polit-Darsteller nun in gleichgeschalteter Einmut verbreiten, in Frage stellen. Im deutschsprachigen Raum sucht man in MS-Medien umsonst nach auch nur einem kritischen Beitrag. Wie man sieht, haben Länder wie Ägypten, Indien, Indonesien oder Nigeria, alles dicht besiedelte Länder, nur einen geringen Anteil doppelt Geimpfter in der Bevölkerung, aber dennoch nichts, was auch nur entfernt an eine Epidemie mit SARS-CoV-2 erinnert. Es gibt keine Pandemie, schon gar keine Pandemie der Ungeimpften. Alle, die wir oben zusammengetragen haben, haben eines gemeinsam: Sie lügen.


10.09.2021 18:49:12 [Kontext Wochenzeitung]
Heckler und Koch: Dinosaurier voll auf Kurs
Jahrzehntelang galt Heckler & Koch als einer der verschwiegendsten Läden im Land. Mittlerweile recycelt der Oberndorfer Waffenhersteller Altwaffen und zumindest die Aktionärsversammlungen sind für die Presse zugänglich. Ein Besuch: Presseanfragen beantwortete man, wenn überhaupt, mit Allgemeinplätzen, Aktionärsversammlungen waren stets nicht öffentlich, das Werk auf dem Oberndorfer Lindenhof für Außenstehende terra incognita: Der Waffenbauer Heckler und Koch war bis vor einiger Zeit Fort Knox in Baden-Württemberg.

Das änderte sich, als vor vier Jahren der inzwischen schon wieder geschasste Vorstandsvorsitzende Norbert Scheuch tatsächlich die Presse einlud, nach einer Aktionärsversammlung mit ihm zu sprechen.

10.09.2021 19:06:16 [Egon W. Kreutzer]
Mit Speck fängt man Mäuse – ein Nachtrag
Zum gestrigen Artikel „Mit Speck fängt man Mäuse – die Impfversuchung“ habe ich eine ganze Reihe von Zuschriften erhalten. Alle zustimmend, jedoch mit unterschiedlicher Perspektive. Teils spürte ich Angst und Resignation, teils trotzigen Durchhaltewillen, teils gab es kämpferische Töne, die mehr als nur den Willen zum passiven Widerstand zum Ausdruck brachten.

Darunter war auch eine Mail, deren Inhalt ich nicht wiedergeben kann, um die Anonymität des Absenders zu wahren, die ich jedoch auf Grund der tiefen Besorgnis, die darin zum Ausdruck kam, ziemlich ausführlich beantwortet habe.

Diese Antwort mache ich hier öffentlich.

11.09.2021 09:53:46 [Heise]
"Team Wallraff": Angstkultur, Dumping und Retouren-Zerstörung bei Amazon
158 Pakete verschickt Amazon pro Sekunde, teils werden sie noch am gleichen Tag an weltweit über 300 Millionen Kunden geliefert. Doch der Service des E-Commerce-Imperiums hat seinen Preis, wollen Reporter vom "Team Wallraff" herausgefunden haben. Sie berichteten am Donnerstagabend zur Primetime auf RTL in der Sendung "Undercover bei Amazon" über Sozial- und Lohndumping, ein System der Ausbeutung, Überwachung und Angst bei dem Versandriesen.

Den Journalisten um Enthüller Günter Wallraff gelang es demnach, sich in unterschiedliche Unternehmensbereiche einzuschleusen und dort zu recherchieren.

11.09.2021 12:09:19 [Norbert Häring]
Wo die Vierte Welle hinrollt
Die Vierte Welle rollt und sie droht schrecklich zu werden, heißt es. Deshalb seien drastische Freiheitseinschränkungen für Ungeimpfte nötig, die diese Infektionswelle oder „Pandemie der Ungeimpften“ schließlich auch verursachen. Ein Blick auf die Zahlen des Inzidenz-Spitzenreiters ist erhellend.

Laut Hessenschau hat meine Nachbarstadt Offenbach bundesweit die höchste Inzidenz aller Landkreise und Städte. Laut Daten des Robert-Koch-Instituts vom Freitag sei der Wert der Neuinfektionen pro 100.000 Einwohner in den vergangenen sieben Tagen auf 236,1 gestiegen. Was bedeutet das nun für einen bestehenden oder vielleicht absehbaren Gesundheitsnotstand.

11.09.2021 14:05:41 [Krass & Konkret]
9/11: US-Regierung gibt sich lernresistent
US-Präsident Joe Biden hat, vorbereitet von seinem Amtsvorgänger Donald Trump, mit dem Abzug der US-Truppen aus Afghanistan kurz vor dem 20. Jahrestag der 9/11-Anschläge und dem darauf folgenden Beginn des Kriegs gegen den Terror – George W. Bush hatte von Kreuzzug gesprochen – ein Zeichen für die Amerikaner setzen wollen. Das ging grandios daneben und muss nun als Warnung für alle Alliierten gelten und als Bestärkung für alle Islamisten: Dschihad lohnt sich, wenn die Gotteskrieger lange genug kämpfen.
11.09.2021 17:19:43 [NachDenkSeiten]
Wie ich zum „Afghanen“ wurde
Im Westen fand mit dem 11. September 2001 eine Zäsur statt. Eine Welle des antimuslimischen Rassismus nahm ihren Anfang, Menschen wie ich erlebten Hass und Diskriminierung und sie tun es weiterhin. Der Tag war auch der Anfangspunkt einer langen Entwicklung, die mich zu dem gemacht hat, was ich heute bin: Fortan war ich der ewige Erklärer des Krieges in Afghanistan, ein Land, das ich als Jugendlicher zum ersten Mal bereiste. Am 11. September 2001 war ich neun Jahre alt und lebte in Innsbruck. Dort war ich geboren und aufgewachsen, dort ging ich zur Schule. Rund zwei Jahre zuvor hatten meine Familie und ich die österreichische Staatsbürgerschaft erhalten. Jenseits der Tiroler Alpen hatte ich noch nicht viel gesehen, über das Land meiner Eltern wusste ich praktisch nichts.
11.09.2021 17:29:29 [Ständige Publikumskonferenz]
ARD-Dokureihe „Deutschland 9/11“: Milde Mainstream-Propaganda
NDR, SWR und RBB servieren süffiges Infotainment: Katastrophenszenen, unterlegt mit Thrillermusik und garniert mit Betroffenentränen – ausgefeilte Propaganda, die den Zuschauer unterhalten, emotional manipulieren und von der Wahrheit ablenken soll.

Zum 20. Jahrestag der 9/11-Anschläge beglückt uns die ARD-Senderfamilie mit einer linientreuen Doku über den angeblichen Ablauf des Einsturzes der Zwillingstürme des WTC (Worldtradecenter) am 11. September 2001. Leider wiederholt die Doku kritiklos alle Lügen und Weglassungen der offiziellen US-Regierungsversion. Dabei weiß jeder, der eine Minute recherchiert, dass nicht nur diese beiden Türme WTC 1 und 2, sondern auch noch eine dritter, WTC7, am 9.11.2001 einstürzten.

11.09.2021 19:08:48 [Egon W. Kreutzer]
Grabräuber und Wahlfälscher
Wie sicher ist es, dass das amtliche Wahlergebnis auch dem entspricht, was die Wähler angekreuzt haben?
Dieser Tage kam ja heraus, dass die in Deutschland seit langer Zeit verwendete Software zur Ergebnismeldung - von der Auszählung im Wahllokal bis zur Summenbildung beim Bundeswahlleiter - von äußerst zweifelhafter Qualität ist, weil sie Manipulationen Tür und Tor öffnet.
Doch die meisten Manipulationen geschehen ganz offen, am hellen Tag, lange bevor die Wahllokale öffnen. Wahlmanipulationen vor der Wahl finden öffentlich statt, sind aber nicht leicht als solche zu erkennen und nur mit Insiderkenntnissen nachzuweisen.

Es handelt sich im Wesentlichen um fünf Methoden, die immer wieder mit Erfolg zur Anwendung kommen.

12.09.2021 10:01:55 [Junge Welt]
»Der Verfassungsschutz betreibt Amtsanmaßung«
Überwachung von "junge Welt" ist ein schwerer Eingriff in die Pressefreiheit. Ein Gespräch mit Martin Kutscha: Der Verfassungsschutz überwacht mit der jungen Welt eine Tageszeitung. Ich dachte, die Pressefreiheit sei hierzulande ein hohes Gut. Was sagen Sie dazu?

Es ist ein schwerer Grundrechtseingriff. Das gilt auch dann, wenn die Zeitung nicht direkt verboten wird. Schon die Beeinträchtigung der wirtschaftlichen Möglichkeiten einer Zeitung ist auf jeden Fall ein Eingriff in die Pressefreiheit. Der Verfassungsschutz behauptet unter anderem, dass die junge Welt nicht unparteiisch sei. Es ist aber das gute Recht eines jeden Presseerzeugnisses, eine politische Linie zu verfolgen, in diesem Fall eben auch eine marxistische Position zu vertreten.

12.09.2021 14:05:50 [Heise]
20 Jahre 12. September 2001
"Der gestrige terroristische Angriff hat uns noch einmal vor Augen geführt: Sicherheit ist in unserer Welt nicht teilbar. Sie ist nur zu erreichen, wenn wir noch enger für unsere Werte zusammenstehen und bei ihrer Durchsetzung zusammenarbeiten."
(Bundeskanzler Gerhard Schröder am 12. September 2001 im Bundestag) Der Tag auf die Attentate in den USA ist 20 Jahre her und er dauert seitdem an. Auf eine neue Dimension des Terrors folgte eine neue Dimension der Überwachung. Gerne wird behauptet, fast jeder Mensch, der damals gelebt hat und alt genug dafür war, könne sich daran erinnern, wo er an jenem Tag war, als Selbstmordattentäter in den USA Passagier-Flugzeuge entführten und das Pentagon in Washington D.C. und die Türme des World Trade Center rammten.

12.09.2021 14:18:35 [Brave New Europe]
Nobody’s war
Stephen Platt, Professor of Chinese history at the University of Massachusetts, has in “Imperial Twilight” written an excellent book on the origins of the first Opium War, and perhaps even more importantly, at this time of US-China tensions, he has shown how wars may occur not just because the two sides do not agree, not even because of miscalculations and misperceptions, but even when key decision-makers whose behaviour led to war….agree on the main points.

Platt, as one of the commentators wrote, has an eye of a novelist, and the book often reads like a combination of history and historical novel. A number of picturesque characters that have populated China trade in the early 19th century add to that impression.

12.09.2021 15:48:33 [NachDenkSeiten]
Der Pandemievertrag: Sinnvolle Vorsorge oder gefährliche Drohung?
Zum Zweck der Vorsorge soll ein rechtlich bindender internationaler Pandemievertrag ausgearbeitet werden. Die EU unterstützt die Einleitung eines WHO-Verfahrens zur Ausarbeitung eines solchen Vertrages , ein möglicher Beitritt der EU steht im Raum. Aber zum einen sind die inhaltlichen Parallelen des Entwurfs zu den Programmen finanzstarker Stiftungen auffällig. Und zum anderen: Wollen wir das alles überhaupt? „Nach der Pandemie ist vor der Pandemie.“ Mit diesen Worten ließ Angela Merkel im Frühjahr 2021 aufhorchen. Sie betonte, wie wichtig Pandemieprävention sei. Zum Zweck der Vorsorge soll ein rechtlich bindender internationaler Pandemievertrag ausgearbeitet werden.
12.09.2021 17:26:49 [Norbert Häring]
Antidemokraten im Talar – Heute: Ulrich Wagner, Marburg
Corona holt bei vielen das Schlechteste hervor, auch und gerade bei Professoren, von denen es nicht umsonst während der Studentenrevolte vor 50 Jahren hieß, unter den Talaren herrsche der Muff von 1000 Jahren. Ein Beispiel für eine – freundlich ausgedrückt – erschreckend antidemokratische Haltung liefert heute der Marburger Professor für Sozialpsychologie Ulrich Wagner.

In der Hessenschau wird Professor Dr. Ulrich Wagner zitiert mit der Forderung:

Die Politik dürfe nicht herumlavieren. „Es braucht eine eindeutige, klare Norm.“ Wagner fordert eine klares Bekenntnis zu 2G. Impfgegnerinnen und Gegnern müsse die Botschaft gesendet werden: „Ihr seid hier die Minderheit.“

Wer in der Minderheit ist, hat keine Rechte mehr, muss draußen bleiben. Gegen Minderheiten darf gehetzt werden. Hatten wir alles schon mal.

13.09.2021 07:18:33 [Epoch Times]
Der Kampf um Intensivbett-Daten
In einem geleakten Newsletter des DIVI-Intensivregister-Teams werden Kliniken aufgefordert, die Herausgabe von Intensivbett-Daten zu verweigern. Auf Anfrage von Epoch Times dementiert DIVI dies nicht. Das Bundesgesundheitsministerium verkündete einen Tag später im ZDF, die Länder würden dem Bund Intensivbettendaten verweigern. Die geleakte E-Mail von DIVI wirft nun neues Licht auf die Glaubwürdigkeit dieser Aussage.

Das Intensivbettenregister der „Deutschen Interdisziplinären Vereinigung von Intensiv- und Notfallmedizin“ (DIVI) dient zur Echtzeiterfassung von Intensivbetten-Kapazitäten.

13.09.2021 12:17:16 [German Foreign Policy]
Fruchtbarer Boden für Jihadisten
20 Jahre nach dem 11. September 2001 bleibt die Rolle Saudi-Arabiens, eines der engsten Verbündeten Deutschlands am Persischen Golf, bei der Vorbereitung der damaligen Anschläge ungeklärt. Unter wachsendem Druck von Angehörigen der Opfer, die sich gerichtlich um Aufklärung bemühen, hat US-Präsident Joe Biden angekündigt, eine Reihe von Dokumenten zu veröffentlichen, die Aufschlüsse geben sollen, ob und inwieweit saudische Stellen die Attentäter unterstützten. Das erste, am Wochenende publizierte Papier liefert keine entscheidenden Informationen. Die US-Regierung behindert die Aufklärung seit Jahren.
13.09.2021 13:48:57 [Liberale Warte]
Boris Johnson muss sich dem Willen der Bürger beugen
Um die eigene Situation besser einschätzen zu können, ist es hilfreich, immer mal wieder über den Tellerrand zu schauen. Ein Blick ins Ausland hilft da sehr. Vor allem, wenn dieser Blick auf eine der ältesten Demokratien der Welt fällt. Gerade in den aktuellen Zeiten offenbart sich, wie wichtig eine tief verankerte demokratische Kultur ist. Besonders ausgeprägt ist diese im Vereinigten Königreich. Aber nicht nur dort wächst das Unbehagen der Bürger angesichts einer immer größeren staatlichen Übergriffigkeit, sondern auch in vielen anderen Teilen Europas.
13.09.2021 13:58:53 [Police IT]
Fall Amad A: Datenlöschung von Verstorbenen in INPOL-Zentral
Im Fall Amad A. fand in den letzten Monaten ein Tanz um die Frage statt, welche Daten eigentlich noch vorhanden sind bzw. gelöscht wurden. Die Aussagen von Innenminister Reul und der zuständigen Oberstaatsanwältin dazu wurden mehrfach geändert. Unter anderem wurde auch noch das Bundeskriminalamt einer angeblich „unvermeidlichen“ Löschoperation bezichtigt. POLICE-IT hat daher beim BKA mal nachgefragt, wie lange denn die Daten in INPOL-Zentral überleben, nachdem der dazu gehörende Mensch gestorben ist. Nur mit etwas Aufwand gelingt es noch, bei den diversen, zum Teil widersprüchlichen Aussagen zu dieser Frage die Übersicht zu behalten. |
13.09.2021 17:17:32 [NachDenkSeiten]
Ein Wochenende tumber Meinungsmache zur Bundestagswahl
Am Samstag empfing die CSU den gemeinsamen Kanzlerkandidaten Laschet mit arrangiertem Applaus. Dementsprechend wurde dann Laschets Rede als der große Durchbruch gefeiert. Basis des Laschet-Wunders von Nürnberg war ein fundamentaler Angriff auf die SPD wegen angeblichen Totalversagens in der Vergangenheit und auf die mögliche Beteiligung der Linkspartei an einer künftigen Koalition. An diesem seidenen Faden hängt das Schicksal unserer Nation! Diesen Eindruck musste man auch beim Einstieg in das sogenannte Triell von gestern Abend gewinnen.
13.09.2021 19:07:09 [Aktuelle Sozialpolitik]
Aufstocker im Hartz IV-System
Aus dem ganz eigenen Hartz IV-Universum, in dem sich Millionen Menschen bewegen müssen, kommen tonnenweise Urteile der Sozialgerichtsbarkeit. Entscheidungen wie diese: »Einem als Hartz-IV-Aufstocker staatlich unterstützten Berliner Kellner darf die Unterstützung gekürzt werden, weil ihn sein Arbeitgeber an jedem Arbeitstag mit Essen versorgt.« Das hat das Bundessozialgericht in Kassel entschieden und wies damit die Revision gegen eine entsprechende Entscheidung des Landessozialgerichts Berlin-Brandenburg zurück. »Demnach stellt das im Arbeitsvertrag zugesicherte Essen des Kellners ein Einkommen dar. Dieses dürfe folglich bei der Berechnung der Hartz-IV-Leistungen mit berücksichtigt werden.
13.09.2021 19:09:41 [Egon W. Kreutzer]
Scheingefechte in der ARD
Was war das, gestern Abend in der ARD? War es eine Art vorgezogene Koalitionsverhandlung, eine öffentliche Versteigerung der Grünen-Sitze im nächsten Bundestag an den meistbietenden Kanzlerkandidaten? Oder war es einfach nur ein neuer Akt des Schauspiels: "Demokratie ohne Opposition"? Gibt es so etwas, wie eine Platzhirschin?

Falls ja, dann hat sich Maybrit Illner gestern als solche inszeniert. Ihr Co-Moderator konnte einem echt leid tun, wenn sie ein ums andere Mal dazwischengrätschte, wenn er glaubte, nach dem abgesprochenen Drehbuch an der Reihe zu sein.

14.09.2021 06:39:00 [Radio FM4]
Was die Pentagon-Datenbanken über Afghanistan verraten
Seit dem Abschluss des infamen „Friedensabkommens“ der Trump-Regierung mit den Taliban Anfang 2020 gingen noch 300 Millionen Dollar an die afghanische Luftwaffe. Ein Lagebericht von Ende 2020 wirft ein Schlaglicht auf die „Kampfbereitschaft“ der afghanischen Armee. Die Gelder an die US-Vertragsfirmen für die Streitkräfte Afghanistans flossen bis zur letzten Minute. Noch am 10. Juni wurden 44 Millionen Dollar an McDonnell Douglas für Logistikdienstleistungen und Reparaturservices ausbezahlt. Die Arbeiten für die afghanische Luftwaffe sollten bis Ende November abgeschlossen sein.
14.09.2021 09:09:12 [Ceiberweiber]
Der „Spiegel“ und die Eurofighter-Affäre
Letzte Woche durften wir erleben, dass zum Prozess gegen Julian Hessenthaler Menschenrechtsorganisationen aufmarschierten, obwohl es um Drogendelikte ging. Es stand im Raum, dass ihm diese untergeschoben werden, um ihn nicht direkt wegen des Ibiza-Videos dingfest zu machen. Nun legt „Deutschlands renommiertester Menschenrechtsanwalt“ Wolfgang Kaleck nach, indem er das Verfahren „orwellesk“ nennt, wobei er inhaltlich allen auch vom „Spiegel“ verbreiteten Narrativen folgt. Ich wies ihn und die Redaktion bereits per Mail auf einige nicht berücksichtigte Zusammenhänge hin, die angesprochene Korruption in einem wesentlich größeren Rahmen erscheinen lassen.
14.09.2021 14:51:26 [Telepolis]
Mit "Lollis" und Kasperl gegen Covid-19
Um eine erneute Infektionswelle an Kitas und Schulen zu verhindern, sollen nun "Lollitests" und der Kasperl helfen. Vor allem die bayerische Landesregierung setzt auf die neue Testmethode, bei der die Kinder an zwei Tupfern lutschen, um Speichelproben abzugeben.

Diese Proben werden dann gemeinsam als Pool untersucht. Diese Methode soll verlässlicher sein als die individuellen Schnelltests, die entweder an den Schulen oder vorab zu Hause durchgeführt werden.

Gegenüber der "Augsburger Allgemeinen Zeitung" sagte Bayerns Ministerpräsident Markus Söder (CSU): "Wir wollen noch mehr Sicherheit in den Kitas, wir werden daher auf Wunsch der Eltern die Lollitests ermöglichen."

14.09.2021 14:56:08 [RT DE]
Der SWR und die Meinungsfreiheit
Am 06. September sendete die ARD eine vom SWR produzierte Dokumentation mit dem Titel "Die geheimen Meinungsmacher – Wie wir im Wahlkampf manipuliert werden". Dieser Film ist einer genaueren Betrachtung wert, da er selbst ein Musterbeispiel für Manipulation ist. Vorab, und das kann man nicht oft genug wiederholen, das Grundrecht, das Artikel 5 des Grundgesetzes gewährleistet, lautet: "Jeder hat das Recht, seine Meinung in Wort, Schrift und Bild frei zu äußern und zu verbreiten." Es heißt nicht: "Jeder hat das Recht, das, was amtlich für wahr befunden wird, in Wort, Schrift und Bild frei zu äußern." Es ist keine Wahrheitsfreiheit.
14.09.2021 16:44:18 [Telepolis]
Diese Opfer forderten bundesrepublikanisch-deutsche Kriege
Die Rolle Deutschlands als Verbündeter der USA und Mitglied in der Nato mündet in einer anteilsmäßigen Verantwortlichkeit für viele Tausend Tote, Hunderttausende Verletzte und ungezählte Vertriebene pro Jahr. Die Glaubwürdigkeit der gebetsmühlenhaften Forderung aus Politik und Medien nach Akzeptanz der Corona-Maßnahmen aus "Solidarität mit den Risikogruppen", löst sich von selbst in Nichts auf, wenn man die Opferzahlen all der anderen Bereiche politischen Falsch- oder Nichthandelns betrachtet. Hier wird durch gezielte Unterlassung entsprechender Maßnahmen aus wirtschaftlichen und ideologischen Erwägungen heraus, ein Vielfaches an vorzeitigen Todesfällen pro Jahr verursacht und lapidar hingenommen.
14.09.2021 16:51:36 [Egon W. Kreutzer]
Hey Big Spender
Heiko spendet.

Die Geberkonferenz für Afghanistan hat weltweit über eine Milliarde Dollar an Zusagen erbracht. Die Erfahrung lehrt, dass „Zusagen“ seliger ist als „Geben“. Herr Guterres wird also froh sein müssen, wenn von der Milliarde am Ende jene 600 Millionen tatsächlich auf den Weg gebracht werden, die er sich anfänglich erhofft hatte.

Unser – auf besondere Weise auf sein Äußeres bedachter Minister für Äußere Angelegenheiten – äußerte, so heißt es jedenfalls mancherorts, er alleine habe davon 100 Millionen zugesagt. Andernorts liest man, er alleine habe noch weitere 500 Millionen angekündigt.

15.09.2021 07:13:39 [Anarchistische Bibliothek]
Bevölkerungskontrolle - Mithilfe digitaler Impf- und Gesundheitsbescheinigungen
Ohne großes Aufhebens wurde in Deutschland, in Europa sowie in einigen Metropolen weltweit ein digitaler Impfnachweis für Immunisierungsimpfungen gegen Corona eingeführt. Während die digitalen Nachweise bislang vor allem als ergänzende Insellösungen neben dem bereits seit Jahrzehnten verbreiteten analogen Impfpass existieren, arbeitet die WHO, die Weltgesundheitsorganisation, daran, eine internationale Variante des digitalen Impfnachweises zu entwickeln. Der Vorschlag, die im Impfpass festgehaltenen Daten digital verfügbar zu machen ist dabei nicht neu. Seit Jahren experimentieren Philantropenorganisationen wie die GAVI in vorrangig kolonialen Feldversuchen damit, Gesundheitsdaten von Bevölkerungen einheitlich und flächendeckend zu erfassen und mithilfe digitaler Technologien verwaltbar zu machen.
15.09.2021 11:53:20 [Neuland Rebellen]
So ein ungeimpftes Leben
Neulich telefonierte ich mit Tom. Was man da so bespricht, ist ja klar. Es gibt kein anderes Thema mehr. Nirgends. In Hamburg hatten sie gerade diese protofaschistische Albernheit verabschiedet, die sie 2G nennen. Nicht dass ich zuversichtlich gewesen wäre, aber ich fragte Tom, ob er denn die Einwände der Justizministerin Lambrecht vom Wochenende vernommen hätte: Sie sei der Ansicht, dass diese Diskriminierung Ungeimpfter grundgesetzwidrig sei. Tom war unbeeindruckt. So ein Wischiwaschi kriegt man ja ständig zu hören – und tagsdrauf ist schon wieder alles anders.

Er hatte recht. Fünf Tage nachdem Frau Lambrecht sich kritisch äußerte, ließ sie vernehmen, dass sie bei 2G keine Probleme sähe.

15.09.2021 11:56:26 [Norbert Häring]
Dänemarks Regierung löst ein Versprechen ein, das unabhängig von der Impfquote war
Die hohe Impfquote macht es möglich, dass Dänemark – anders als Deutschland – die coronabedingten Einschränkungen der Grundrechte aufhebt, heißt es unisono. Aber: Schwedens Regierung tut es auch, trotz niedrigerer Impfquote. Und: Das Maßnahmenende Dänemarks war versprochen, für die Zeit, wenn alle die Chance hatten, sich impfen zu lassen, unabhängig von der Quote. Anders als die gewohnheitsmäßig wortbrüchige deutsche, löst die dänische Regierung ihr Versprechen ein.

In den Berichten über die Beendigung aller Grundrechtseinschränkungen in Dänemark wird geflissentlich vergessen zu erwähnen, dass die Regierung damit ein Versprechen einlöst, das sie vor einem halben Jahr gegeben hat.

15.09.2021 17:22:29 [Übermedien]
Triell: Wie sich ARD und ZDF zugunsten von Olaf Scholz verrechneten
Eines war Moderatorin Maybrit Illner bei der Debatte der Kanzlerkandidaten am Sonntag in ARD und ZDF ganz besonders wichtig: dass die Redeanteile unter den dreien „einigermaßen fair verteilt sind“. Darauf wies sie gleich am Anfang und im Verlauf der Sendung immer wieder hin.

Diese Aufgabe stellte für die Macher allerdings eine größere Herausforderung dar. Als Illner nach knapp 40 Minuten den Befragten umständlich attestierte, dass sie sich „sehr fair untereinander verteilt haben in Bezug auf die Zeit Ihres Redens und Ihrer Äußerungen“, machte Annalena Baerbock von den Grünen auf ein Problem aufmerksam: „Die Uhr von Herrn Scholz läuft noch weiter“ – obwohl der längst nicht mehr redete.

15.09.2021 18:57:37 [RT DE]
Fertigstellung von Nord Stream 2: Die Ukraine sollte jetzt klug vorgehen
Trotz aller Kontroversen und Widerstände wurde die 1.224 Kilometer lange und 11 Milliarden US-Dollar teure unterseeische Gasverbindung fertiggestellt, wodurch Russlands Kapazität, Gas durch die Ostsee zu exportieren [neben Nord Stream seit 2011] verdoppelt wird. Jetzt wo das letzte Rohrsegment verschweißt ist, könnte das Gas bereits ab Oktober fließen. Während einige deutsche Regulierungsentscheidungen noch ausstehen, gibt es derzeit keine erkennbaren Anzeichen mehr, dass Nord Stream 2 noch blockiert werden könnte.
16.09.2021 07:05:19 [Frag den Staat]
Frontex abschaffen
Die EU-Grenzschutzagentur Frontex hat lange Zeit behauptet, dass Such- und Rettungsmaßnahmen ein wesentlicher Bestandteil ihrer Operationen auf See sind. Neue Recherchen zeigen, wie Frontex daran gearbeitet hat, ihre Rettungskapazitäten nutzlos zu machen - und das auf Kosten von Menschenleben. Die europäischen Staaten sind nach internationalem Seerecht dazu verpflichtet, Menschen in Seenot zu retten. Seit vielen Jahren fordern die Zivilgesellschaft, internationale Organisationen sowie einzelne Bürger, dass die EU dieser Verpflichtung nachkommen solle und die notwendigen Ressourcen aufbringen solle, um Menschen vor dem Ertrinken zu bewahren.
 Deutschland (70)
01.09.2021 06:47:36 [WSWS]
Lage in Flutkatastrophen-Gebieten nach wie vor katastrophal
Sieben Wochen nach der verheerenden Flutkatastrophe in Rheinland-Pfalz und Nordrhein-Westfalen ist die Lage in den betroffenen Gebieten nach wie vor katastrophal. Die Opfer der Katastrophe sind weitgehend auf sich allein gestellt.

Sie werden zwar von Tausenden Freiwilligen aus nah und fern unterstützt, die praktisch sofort nach der Flut zu Hilfe eilten und beim Saubermachen, der Essensversorgung und vielen anderen dringenden Arbeiten helfen. Doch von den Behörden und den Landesregierungen gibt es kaum tatkräftige Unterstützung. Viele Flutopfer sind wütend über ihre Untätigkeit. Auch die Freiwilligen sind fassungslos, dass von den Behörden so gut wie keine organisierte Hilfe kommt.

01.09.2021 11:15:30 [Tichys Einblick]
Unter Winfried Kretschmann wird das anonyme Denunziantentum gefördert
Wer wissen möchte, was den deutschen Bürgern unter einem grünen Finanzminister, beispielsweise Robert Habeck, außer fundamentalen Wissens-Canyons über Basel-III-Regeln bis hin zur Pendlerpauschale erwartet, muss nur nach Baden-Württemberg schauen. Des Grünen Ministerpräsidenten Winfried Kretschmanns grüner Finanzminister Danyal Bayaz hat am 30.08.2021 ein Portal freischalten lassen, auf dem Bürger im überschäumenden Gerechtigkeitsverlangen oder in wilder Denunziationslust den Mitbürger anschwärzen dürfen, wenn der womöglich einen Cent an der Steuer vorbeizutragen gedenkt.
01.09.2021 14:17:50 [RT DE]
Bei 80 Prozent der „COVID-19-Toten“ war Corona nicht die wirkliche Todesursache
Das Robert Koch-Institut (RKI) meldet zu viele Verstorbene "im Zusammenhang mit COVID-19". Darauf macht das unabhängige Institut IGES (Infrastruktur und Gesundheit) in Berlin in seinem aktuellen "Pandemie Monitor" aufmerksam. Darin heißt es: "Vom 1. bis 19.8.2021 sind pro Tag im Mittel 18 Sterbefälle gemeldet worden, von den nur sieben Personen zuzurechnen sind, die max. fünf Wochen vorher infiziert worden sind. Elf Fälle entfallen auf Personen, deren Infektion länger zurückliegt." Bei den gemeldeten verstorbenen Menschen könne es sich um solche handeln, die 2020 positiv auf das Virus SARS-CoV-2 getestet worden waren, "jetzt aber an Herzversagen gestorben" seien. Das Meldesystem des RKI verzerre zunehmend die Sterbestatistik, so Häussler gegenüber der "Welt".
01.09.2021 15:48:33 [Reitschuster]
Reden ist Silber, Schweigen ist Scholz
An den Rändern rechts und links unserer Umfragerepublik sind die Prozente ausgesprochen stabil. Die AfD dümpelt bei elf Prozent und die Linken bei sieben.

Bei den Parteien, die im Geschäft sind, zeigt sich jedoch eine ausgeprägte Wähler-Volatilität. Die Union ist im Sturzflug und die Grünen legen, entsprechend ihrer Mentalität des sanften gesellschaftlichen Absturzes, einen Gleitflug ohne Motor hin. Sie verlieren in zwei Wochen jeweils ein halbes Prozent, aber das konstant. Inzwischen haben sie die Sechzehn-Prozent-Marke erreicht und in ihren Wahlflieger immer noch keinen Motor eingebaut. Das Klima muss helfen, am besten mit einer starken Thermik. Aber die bleibt wohl in den nächsten Wochen aus.

01.09.2021 16:03:57 [RT DE]
2G und die Menschenwürde
Immer stärker wird der Druck aus der Politik, eine Regel, die nur noch Geimpften und Genesenen ein halbwegs normales Leben gewährt, privatrechtlich durchzusetzen. Damit werden alle Fortschritte der letzten Jahrzehnte im Kampf gegen Diskriminierung mit einem Tritt in die Tonne befördert. Seit Corona ist das Leben ein Hürdenlauf, und die Hürden werden, damit das Ganze nicht zu einfach wird, regelmäßig anders aufgestellt. Die neueste Erfindung in diesem Zusammenhang nennt sich "2G" und ist die Weiterentwicklung des schon zutiefst unlogischen "3G" vom Frühjahr. Unlogisch, weil die Annahme, Genesene hätten einen schwächeren Schutz als Geimpfte, sämtlichen Erfahrungen mit anderen Erkrankungen widersprach und inzwischen auch durch Studien über Corona widerlegt ist.
01.09.2021 17:52:29 [Der Freitag]
Wie wollen wir das unseren Kindern erklären?
Für Politik und Medien gibt es kaum ein dringlicheres Thema, als dass Annalena Baerbock und Olaf Scholz eine Koalition mit der Linkspartei ausschließen. Warum eigentlich? Montag Abend eröffnete Marietta Slomka das ZDF-„Heute Journal“ mit einem Beitrag über das „ungeklärte“ Verhältnis der SPD zur Linkspartei. Im Prinzip betätigte sie sich damit als Echo der verzweifelten Kampagne von CDU und FDP, mit der Grüne und SPD gezwungen werden sollen, ein Linksbündnis von vornherein auszuschließen. Sie wiederholte einfach die Fragen, die Armin Laschet am Sonntagabend im Triell gestellt hatte, drei Mal, glaube ich.
01.09.2021 19:23:17 [Frankfurter Allgemeine Zeitung]
Brinkhaus erwägt Ausschluss von Impfverweigerern aus sensiblen Berufen
(Anm. v. NNE: Die Erkenntnis, dass Geimpfte die gleiche Viruslast tragen können wie Ungeimpfte, hat den Vorsitzenden der Unionsfraktion offenbar [noch] nicht erreicht. Andernfalls wäre sein Anliegen unverantwortlich.) Angesichts der steigenden Infektionszahlen nimmt der Druck auf impfunwillige Beschäftigte im Erziehungsbereich und in der Pflege zu. Auf die Frage, ob man nach der Bundestagswahl über eine Impfpflicht reden müsse, sagte Unionsfraktionschef Ralph Brinkhaus dem Spiegel: „Wir haben uns immer dagegen ausgesprochen. Aber wir müssen uns die sensitiven Bereiche ansehen. Wenn sich jemand Sorgen macht, weil sich eine Kita-Erzieherin nicht impfen lässt, nehme ich das sehr ernst.“
01.09.2021 19:25:14 [Kontext Wochenzeitung]
Grüne wollen Scheuers Stuhl
Nicht das Maut-Debakel oder das Scheitern des Bußgeldkatalogs sind das, was Matthias Gastel dem aktuellen Bundesverkehrsminister Andreas Scheuer (CSU) am meisten ankreidet. Sondern zwei Zahlen: 124 zu Null. 124 Kilometer neue Autostraßen wurden in Deutschland in der noch laufenden Legislaturperiode gebaut, aber null Kilometer neue Schienen. Die Zahlen stehen für eine Infrastrukturpolitik, die völlig in die falsche Richtung gehe. "Dazu passt auch, dass im laufenden Haushalt doppelt so viel Geld für den Aus- und Neubau von Straßen eingeplant ist wie für Schienenwege", kritisiert der Grüne Gastel, der seit 2013 für den Wahlkreis Nürtingen im Bundestag sitzt und aktuell bahnpolitischer Sprecher seiner Fraktion ist.
06.09.2021 07:10:44 [Telepolis]
Hamburg: Mann kennt sich, Mann hilft sich
Die Grünenpolitikerin Annalena Baerbock gilt vielen für das Amt der Bundeskanzlerin als untragbar, weil sie in ihrem Lebenslauf zu dick auftrug. Mitbewerber Armin Laschet (CDU) disqualifizierte sich in den Augen vieler durch sein unangemessenes Lachen während der Flutkatastrophe in Westdeutschland.

Von diesen Fauxpas profitiert überraschenderweise Finanzminister und SPD-Kanzlerkandidat Olaf Scholz. Und dies, obwohl ihm vorgeworfen wird, seine Hand schützend über Steuersünder zu halten. Das tut seiner Beliebtheit offensichtlich keinen Abbruch, noch weniger führt es zu Rücktrittsforderungen.

06.09.2021 07:26:47 [Kontext Wochenzeitung]
Krieg oder Krieg
Die Linke hat ein Alleinstellungsmerkmal. "Wir sind die Friedenspartei und verlässliche Stimme der Friedensbewegung im Bundestag", heißt es im Wahlprogramm. Keine der anderen Parteien kann das für sich in Anspruch nehmen. Angesichts der Katastrophe in Afghanistan geraten diese Worte an ihre Grenzen. "Afghanistan zeigt auf tragische Weise, dass Auslandseinsätze falsch sind", sagt Tobias Pflüger, der verteidigungspolitische Sprecher der Linksfraktion im Bundestag. Und er hat recht mit seiner Forderung, statt militärischer Ausbildung sollten zivile Kräfte vor Ort unterstützt und aufgebaut werden. Das aber ist nicht oder viel zu wenig geschehen in den 20 Jahren, seit der Westen einmarschiert ist.
06.09.2021 11:44:08 [Reitschuster]
Volksverdummung mit Inzidenzzahlen
In Corona-Zeiten häufen sich bei mir die Momente, in denen ich an meinem eigenen Verstand zweifle. So gerade beim Lesen dieser Nachricht im Nordkurier (einer Zeitung, die ich überaus schätze): „Die vierte Corona-Welle ist eine Welle der Ungeimpften“. Da heißt es: „Es war nur ein kleiner Halbsatz, den Manuela Schwesig … fallen ließ. Demnächst werde man sowohl die Inzidenzwerte von Geimpften als auch von Nicht-Geimpften täglich veröffentlichen… Nun, aus der Anmerkung ist jetzt Realität geworden – inklusive des durchaus vorhandenen politischen Zündstoffs. Denn allein der Blick auf die aktuellen Zahlen verdeutlicht eine enorme Schere, die sich täglich zwischen den Polen Geimpfte und Nicht-Geimpfte immer mehr spreizt.
06.09.2021 11:46:54 [Frankfurter Allgemeine Zeitung]
Laschet attackiert Scholz für Versuchskaninchen-Äußerung
(Anm. v. NNE: Einmal sagt Scholz die Wahrheit, denn wir erleben vermutlich gerade das größte pharmakologische Experiment der Menschheitsgeschichte und schon regen sich alle auf.) Artikeltext: Unions-Kanzlerkandidat Armin Laschet hat dem SPD-Kandidaten Olaf Scholz Verantwortungslosigkeit vorgeworfen, weil er Geimpfte als „Versuchskaninchen“ bezeichnet hat. „Das ist eine unverantwortliche Antwort, die er da gibt“, sagte Laschet am Samstag auf dem Parteitag der CDU Brandenburg mit Hinweis auf Scholz-Äußerungen, die er unter anderem am Freitag im Gespräch mit Lesern der F.A.Z. getätigt hatte.
06.09.2021 13:35:00 [RT DE]
Sachsen will Kinder nach den Ferien zur Spritze locken
In Sachsen startet das neue Schuljahr mit einer Impfoffensive in den Bildungseinrichtungen. Die Landesregierung will möglichst viele 12- bis 17-Jährige dazu bewegen, sich ein COVID-19-Vakzin von Pfizer/BioNTech oder Moderna injizieren zu lassen. Losgehen soll es am 13. September; vorläufige Termine stehen für nahezu 70 Schulen bereits fest – darunter Gymnasien, Haupt-, Real- und Berufsschulen.

In einem Anschreiben vom 25. August, das der Autorin vorliegt, fordert das sächsische Kultusministerium unter Christian Piwarz (CDU) nun die Schulleiter auf, dafür "Interessensbekundungen" von Kindern, Eltern und Lehrern einzuholen.

06.09.2021 15:02:05 [RT DE]
Werden die Ungeimpften zum statistischen Sündenbock gemacht?
Das Universitätskrankenhaus in Zürich bringt die Diskrepanz auf den Punkt: beim Eintritt ins Spital wird darauf hingewiesen, dass Geimpfte nicht mehr getestet werden. Zitat:

"Falls Sie weder geimpft noch getestet sind, führen wir im Rahmen Ihrer Eintrittsuntersuchungen einen SARS-CoV-2-Test durch. Wenn Sie gegen SARS-CoV-2 geimpft sind, bringen Sie für Ihren stationären Spitaleintritt das COVID-Zertifikat oder den Impfausweis mit."

Wer also eine Impfung vorweisen kann und so seine Freiheit "wiedererlangt" hat, wird sich eben nicht mehr testen lassen und fällt somit fast vollständig aus der Teststatistik heraus, egal ob er jetzt Infektionsträger ist oder nicht.

06.09.2021 18:52:52 [ScienceFiles]
Impf-Versuchskaninchen: SPD-Scholz plaudert es aus
Dass das politische Personal sich nicht aus der Créme de la Créme der Gesellschaft zusammensetzt, weder mit Blick auf Moral, noch mit Blick auf Kompetenz, Intelligenz oder gar Leistung, das ist hinlänglich bekannt. Das, was derzeit über Parteilisten nach oben kommt, ist eher das, was man als Ergebnis eines Race to the Bottom erwarten würde, Leute, die nicht einmal auf den Market for Lemons, den Akerlof so schön beschrieben hat, einen Fuss auf den Boden bekommen. Leute, die ihre Dummheit spazieren tragen, von denen man zuweilen den Eindruck gewinnen muss, dass sie zwei und zwei eben nicht zusammen zählen können.
07.09.2021 11:34:45 [Tichys Einblick]
Armin Laschet im Larifari-Land
Bei einem Wahlkampfauftritt von Armin Laschet in Erfurt, rannte unvermittelt ein Mann auf die Bühne. Er stand mit nur wenigen Zentimetern Abstand Gesicht an Gesicht neben dem CDU-Kanzlerkandidaten, um spürbar emotionalisiert eine Frage zu stellen. Die Szene spielte sich innerhalb weniger Sekunden ab, der anwesende Personenschutz unterband das nicht. Als die Beamten endlich reagieren, weist Laschet sie zurück und nimmt sich des Aktivisten persönlich an. Der CDU-Vorsitzende kann die Situation mit seiner Erfahrung schnell erfassen und rhetorisch geschickt klären.
07.09.2021 19:03:14 [Tichys Einblick]
Umfragetief für die CSU zeigt: Markus Söder ist der Problem-Bär
Nur noch 29 Prozent der bayerischen Wahlberechtigten wollen CSU wählen, so eine Umfrage, die Sat1 für Bayern in Auftrag gegeben hat. Im Juni waren es noch 35 Prozent. Im neuesten RTL/ntv-Trendbarometer sinken CDU und CSU zusammen erstmals unter die 20-Prozentmarke auf 19 Prozent! Das Ergebnis ist keine Überraschung. Historisch liegt die CSU immer rund 8 Prozentpunkte vor der Union, manchmal etwas mehr, selten weniger. CDU plus 8 ist CSU -– diese Regel bestätigt sich, weil Armin Laschet in allen jüngeren Umfragen gerade noch 20 Prozent holt.
08.09.2021 09:28:37 [Junge Welt]
Repression gegen Antifaschisten: Große Inszenierung
Mit einer medialen Inszenierung, die ihresgleichen sucht, beginnt am Mittwoch der Prozess gegen Lina E. und drei weitere Antifaschisten vor dem Oberlandes­gericht Dresden. Ihnen wird vorgeworfen, in verschiedener Form an Angriffen auf Neonazis beteiligt gewesen zu sein. Lina E. wurde nach einer Hausdurchsuchung im November 2020 in Leipzig verhaftet und sitzt seitdem als Hauptangeklagte in Untersuchungshaft. Nachdem die Bundesanwaltschaft in Karlsruhe das Verfahren an sich gezogen hat, wird wegen »Mitgliedschaft in einer kriminellen Vereinigung« nach Pragraph 129 StGB ermittelt.
08.09.2021 09:36:50 [Frankfurter Allgemeine Zeitung]
Immer mehr Corona-Infizierte verweigern Angaben
(Anm. v. NNE: Erinnerungslücken gibt es eben überall. Zum Beispiel erinnern sich Politiker auch nicht mehr an ihre Ankündigung, die Maßnahmen dann zu beenden, wenn jeder ein Impfangebot erhalten hat.) Artikeltext: Die Gesundheitsbehörden klagen über zunehmende Verweigerung von Corona-Infizierten, bei der Nachverfolgung ihrer Kontakte mitzuwirken. In der Region Hannover berichten die Behörden von einem Fall, bei dem der Gast einer Hochzeitsfeier im Nachhinein angab, nicht zu wissen, um wessen Hochzeit es sich gehandelt habe.
08.09.2021 09:42:05 [BZgA]
Empfehlungen für Kommunikationsmaßnamen gegen die Pandemiemüdigkeit
(Anm. v. NNE: Der Alarm wird auch heute weiter hochgehalten und die Angst geschürt. Alles mit dem Ziel, die Entziehung der Grundrechte durchzusetzen und die psychosoziale Gesundheit der jungen Menschen weiterhin mit Füßen zu treten und zu gefährden. Dieser Strategie folgt weiterhin das gesamte bundesdeutsche Establishment und deren Medien.) Artikeltext: Mehrwellige Studien zeigen, dass sich seit einiger Zeit eine gewisse „Pandemiemüdigkeit“ in der
deutschen Bevölkerung feststellen lässt, die sich in einer geringeren Motivation äußert, die
empfohlenen Schutzmaßnahmen einzuhalten. Aus diesem Grund ist es notwendig, neben
adäquaten Regulierungsmaßnahmen, eine wirksame Krisenkommunikation an die junge Zielgruppe zu etablieren.

08.09.2021 15:13:22 [Netzpolitik]
Dicke Rüge für Minister Scheuer wegen Intransparenz
Die Mautaffäre wird Bundesverkehrsminister Andreas Scheuer (CSU) einfach nicht los. Ein Untersuchungsausschuss im Bundestag zerkaute monatelang die Entscheidung seines Ministeriums, trotz massiver rechtlicher Bedenken eine PKW-Maut nur für Ausländer einzuführen. Diese Fehleinschätzung könnte den deutschen Staat viele Millionen Euro an Gerichtskosten und Entschädigung kosten. Unmut gibt es auch über offenkundige Verschleierungstaktiken. Das Bundesverkehrsministerium erklärte, Daten auf Scheuers Handy aus der entscheidenden Phase der Maut-Planung seien gelöscht worden. Seine Beamten machten außerdem 170 Dokumente aus der Mautaffäre zur Verschlusssache.
08.09.2021 15:16:25 [Tichys Einblick]
Armin Laschet und die Abwicklung der CDU
Meinungsumfragen sind keine Wahlresultate, aber wenn sie alle in eine Richtung weisen, geben sie eben doch einen Hinweis auf einen wahrscheinlichen Wahlausgang, namentlich dann, wenn die Wahlen in knapp drei Wochen stattfinden und viele Wähler mutmaßlich schon vorher über Briefwahl ihre Stimme abgeben werden, wenn sie es nicht schon getan haben. Von daher zeichnet sich schon jetzt ein dramatischer Verlust an Stimmen für die CDU ab. Selbst wenn es ihr gelingt, in letzter Minute noch zur SPD, jener lange für halb tot gehaltenen Partei von Rentnern und Pädagogen, aufzuschließen und vielleicht sogar am Ende ein oder zwei Prozent mehr an Stimmen zu gewinnen, der Niedergang bliebe auch dann dramatisch.
08.09.2021 15:26:06 [Tichys Einblick]
Hessens Innenministerium verweigert Transparenz im SEK-Skandal
Längst ist der Skandal um das Frankfurter Spezialeinsatzkommando (SEK) der hessischen Polizei zu einem Kampf zwischen dem Innenminister Peter Beuth (CDU) und einigen SEK-Beamten geworden, die sich vorverurteilt fühlen. Nachdem mehrere SEK-Beamte sich an die Presse wandten, ist jetzt der Innenminister am Zug.

Beuth hatte das SEK Frankfurt wegen Verdacht auf Rechtsextremismus aufgelöst, ohne die Ermittlungsergebnisse abzuwarten. Der schon zuvor durch den NSU 2.0-Skandal angeschlagene Innenminister wollte wohl einen neuen Skandal durch eine voreilige Auflösung der Spezialeinheit verhindern.

08.09.2021 17:29:39 [Der Freitag]
Mehr Migrationspolitik wagen
Bundestagswahl: Erstaunlich kurz sind in diesem Wahlkampf bisher die Themen Migration, Integration und Asyl gekommen. Wir reden erst wieder darüber, seit die Lage in Afghanistan eskaliert. Allerdings dreht sich die öffentliche Diskussion ausschließlich um Fluchtmigration und eigentlich sogar nur um Hilfe für Menschen in Afghanistan. Das ist zwar dringend notwendig, angesichts der Lage von Millionen Afghanen, die vom islamistischen Taliban-Regime bedroht sind. Doch die Diskussion über eines der drängendsten politischen Themen der Zukunft, nämlich über die Frage, wie mit dem weltweiten Migrationsdruck umgegangen werden sollte, fällt ein weiteres Mal unter den Tisch.
08.09.2021 18:46:39 [Tichys Einblick]
Koalition nutzt Hochwasserhilfe aus, um Corona-Maßnahmen durchzusetzen
30 Milliarden Euro für die Opfer der Flutkatastrophe dieses Sommers: Da sind sich alle Parteien, von AfD bis Linke, einig. Doch die Bundesregierung vollführt ihren letzten Akt im Parlament so, dass die Opposition am Ende geschlossen gegen den Fluthilfefonds stimmt. Was ist passiert? Die Bundesregierung will das Infektionsschutzgesetz ändern – und packt diese Änderung kurzerhand mit der Fluthilfe in einen Antrag. Wer Ja zum Hilfsfonds sagen wollte, musste so auch ja zur Infektionsschutzgesetz-Novelle sagen – beides passiert den Bundestag am Ende bloß mit Koalitionsmehrheit.


09.09.2021 11:17:12 [Saskia Ludwig]
Persönliche Erklärung nach § 31 der Geschäftsordnung des Deutschen Bundestages
Sehr geehrter Herr Bundestagspräsident,

Nahezu zwanzig Mal haben wir im Bundestag in den letzten anderthalb Jahren Änderungen am Infektionsschutzgesetz vorgenommen. Mit keinem anderen Gesetz hat sich unser Parlament so oft in so kurzer Zeit beschäftigt, wie mit diesem.

Die Hektik, mit der wir in nahezu jeder Sitzungswoche das Infektionsschutzgesetz weiter ausweiten, um vermeintlich Schlimmeres zu verhindern, kann ich immer weniger nachvollziehen. Die scheinbare Panik, mit der wir in immer kürzer werdenden Abständen das Infektionsschutzgesetz ändern, ist außerhalb des Berliner Regierungsviertels kaum zu spüren. Zum Glück.

09.09.2021 11:24:20 [SoZ - Sozialistische Zeitung]
Die Krisenkanzlerin
Unter der langen Kanzlerschaft von Angela Merkel wurde das System der öffentlichen Daseinsvorsorge stärker zerrüttet als jemals zuvor. Von Vorbereitungen auf den Klimawandel konnte keine Rede sein. Das fällt uns jetzt auf die Füße.

Eigentlich wollte Angela Merkel bereits vor vier Jahren ihren Job an den Nagel hängen, doch die Wahl von Donald Trump und das Drängen von Barack Obama und Emmanuel Macron, angesichts zu erwartender Bocksprünge in Washington weiterzumachen, scheint erfolgreich gewesen zu sein. Für jemand, der lange Nachtrabpolitik hinter die USA betrieben hatte, war Trumps Wahl ein Tiefschlag. So ernannte man sie zur «Führerin des freien Westens».

09.09.2021 15:17:10 [SoZ - Sozialistische Zeitung]
„Armin, der Lügner“
«Wir regieren NRW so, wie ich es mir auch im Bund vorstellen würde», erklärte der amtierende NRW-Ministerpräsident Ende des vergangenen Jahres gegenüber der "Wirtschaftswoche". Das ist eine offene Kampfansage des CDU-Kanzlerkandidaten, denn Umweltschutz und Grundrechte stehen in NRW auf der Abschussliste, auch wenn sich Laschet im Wahlkampf gerne als Umweltfreund und während der Pandemiemaßnahmen zeitweise als Verfechter der Grundrechte aufführte. «Armin, der Lügner» – seit der Flutkatastrophe ist das in NRW häufig zu hören. Denn Laschet hatte da behauptet, sein Bundesland sei Vorreiter in Sachen Klimaschutz.
09.09.2021 16:58:38 [RT DE]
Im Labyrinth der Quarantäne-Lotterie
So ein positiver Schnelltest kann ziemlich Nerven kosten. Wenn man in die Mühlen der Corona-Bürokratie gerät, ist Warten angesagt. Und ohne Tricks würde ich heute noch in der Warteschleife hängen. Ein Bericht aus eigenem Erleben: Der Tag geht schon gut los, wenn man in der Quarantäne-Lotterie verliert. Was das ist? Das wird offiziell Corona-Schnelltest genannt, ist noch an jeder zweiten Straßenecke zu haben und muss – wenn man in einem Hotel wohnt – alle drei Tage vorgelegt werden.

Ich wohne im Hotel, aber nicht, weil ich gerade zu Besuch bin, sondern weil ich noch keine Wohnung in Berlin habe. Und dort bin ich nun seit einigen Monaten.

09.09.2021 17:11:21 [Kontext Wochenzeitung]
Bundestagswahl Steuerpolitik: Kassieren oder blamieren
Der deutsche Südwesten ist nicht gerade als Region bekannt, in der Reiche und Vermögende gnadenlos schikaniert würden. Das Baden-Baden, das schöne Heidelberg und das nicht ganz so schöne Stuttgart gehören zu den bundesweit beliebtesten Wohngegenden für Einfach- und Multimillionäre. Wo Steuerpläne drohen, diesen fleißig zusammengesparten oder auch mühsam geerbten Reichtum zu schmälern, können sie auf den Beistand eines grünen Ministerpräsidenten vertrauen. "Winfried Kretschmann ist die Hoffnung der Firmenerben", titelte die Springer-Zeitung "Welt" im September 2016, als der Rächer der um ein Haar Enterbten behilflich war, im Bundesrat einen Kompromiss zu finden, mit dem sich auch der Nachwuchs umsatzstarker Familienunternehmen arrangieren konnte.
09.09.2021 18:56:32 [Reitschuster]
Prien-Rausschmiss? Das reicht jetzt definitiv nicht mehr
Ich weiß nicht, ob Hans-Georg Maaßen tatsächlich “erschüttert” ist, wie die BILD schreibt, oder einfach nur stinksauer. Jedenfalls ist ihm die schleswig-holsteinische CDU-Kultusministerin Karin Prien in seine intensive Wahlschlacht um das Direktmandat im thüringischen Wahlkreis 196 (Schmalkalden) reingegrätscht, als sie öffentlich aufgerufen hat, dort am 26. September den SPD-Kandidaten zu wählen. Mehr Parteischädigung geht nicht, und ganz sicher hat Prien – vielleicht durch reine Dummheit – auch ihrem Kanzlerkandidaten Armin Laschet einen Bärendienst erwiesen, der von Tag zu Tag an den Umfragen nachlesen kann, wie ihm die Chance auf die Nachfolge von Angela Merkel im Kanzleramt unter den Händen zerbröselt.
10.09.2021 09:38:32 [Der Tagesspiegel]
Partynacht in Münster endet mit 26 Infizierten – trotz 2G
Bei einer Partynacht mit „2G“-Zugangsbeschränkung in einem Club in Münster (NRW) haben sich vergangene Woche mindestens 26 Menschen mit Corona infiziert, hauptsächlich Mittzwanziger. Dabei handele es sich nach bisherigen Erkenntnissen um Impfdurchbrüche und Ansteckungen von bereits Genesenen, berichtete die Stadt Münster am Donnerstag. 20 Infizierte wohnten in Münster. Ein Mitarbeiter des Clubs sei ebenfalls positiv getestet worden.

Die Stadt rechnet damit, dass noch weitere Infektionen bekannt werden. Die Nachverfolgung durch das Gesundheitsamt laufe auf Hochtouren.

10.09.2021 09:43:01 [Tichys Einblick]
Die Bundesregierung erhöht den Druck auf Ungeimpfte
Ein Gesetzesentwurf des Bundesgesundheitsministeriums zeichnet vor, wie sich der Druck auf Ungeimpfte steigen soll. Laut Business Insider, sollen Gratis-Corona-Tests ab 11. Oktober nur noch für vier Bevölkerungsgruppen zur Verfügung gestellt werden: Menschen, die aus gesundheitlichen Gründen nicht geimpft werden können, Menschen, für die es keine Impfempfehlung gibt, Menschen, die Risikopatienten besuchen, und Menschen, die Corona-Symptome aufweisen. Für alle anderen – also die breite Mehrheit der Ungeimpften – wird es ab Oktober richtig teuer.
10.09.2021 11:33:10 [RT DE]
NRW-Schule wollte nur geimpfte Kinder zur Klassenfahrt mitnehmen
In ihrer Impfempfehlung für Kinder und Jugendliche ab zwölf Jahren sprach sich die Ständige Impfkommission (STIKO) am Robert Koch-Institut (RKI) "ausdrücklich dagegen aus, dass bei Kindern und Jugendlichen eine Impfung zur Voraussetzung von sozialer Teilhabe gemacht wird".

Doch genau das praktizierte nun beispielsweise die Realschule Lünen-Brambauer in Nordrhein-Westfalen (NRW). Diese will nach einer Corona-Pause im kommenden Februar wieder ihre "beliebte Schul-Skifahrt" nach Österreich mit Achtklässlern unternehmen. In einem Brief wurde den Eltern und Schülern jedoch mitgeteilt, dass nur doppelt geimpfte Jugendliche mitkommen dürfen.

10.09.2021 11:40:29 [Kontext Wochenzeitung]
Meldeplattform für Steuerbetrug: Entlarvende Empörung
So also stellt sich die Mittelstands- und Wirtschaftsunion (MIT) das Zusammenleben in Baden-Württemberg vor. Bastian Atzger, früher Kreisgeschäftsführer der Stuttgarter CDU und jetzt Beisitzer im MIT-Landesvorstand, rühmt sich in seinem Lebenslauf einer schon früh entdeckten Beobachtungsgabe. Trotzdem oder gerade deshalb befürchtet er, "dass künftig der missgünstige Nachbar einem Bauherrn hinterherspioniert, wenn ein Handwerker dessen Grundstück betritt, und dann vorsorglich schon mal eine Verdachtsmeldung an die Finanzbehörden absetzt".

Mit seinem Generalverdacht gegen die Nachbarschaft ist Atzger in schlechter Gesellschaft.

10.09.2021 13:14:14 [Junge Welt]
Sozialpartnerschaft: Auf Augenhöhe mit den Bossen
Am Landgericht Braunschweig wird seit Dienstag eine brisante Frage verhandelt: Hat Volkswagen die Loyalität seiner Betriebsräte erkauft? Mehr als fünf Millionen Euro zuviel sollen an fünf hochrangige Personalvertreter geflossen sein, darunter den ehemaligen Betriebsratschef Bernd Osterloh. Vier Personalmanager müssen sich deshalb nun vor dem Gericht wegen Untreue verantworten.

Der Prozess dürfte auch in anderen Unternehmen aufmerksam beobachtet werden. Viele bewegen sich mit übertariflichen Vergütungen von Betriebsräten in einer Grauzone. Denn nach dem Betriebsverfassungsgesetz ist die Tätigkeit als Betriebsrat ein Ehrenamt.

10.09.2021 15:12:24 [Tichys Einblick]
Boris Palmer hält Entlassungen von ungeimpftem Pflegepersonal für möglich
Oft wird sich darüber aufgeregt, dass dieser Wahlkampf so inhaltsleer wäre. Doch die Sache hat auch etwas Gutes: nämlich dass die ganze Corona-Panikmache wenigstens zum Teil runtergeschraubt wird. Auf keinem Wahlplakat der großen Parteien wird Corona thematisiert. Das kann das ZDF allerdings so gar nicht ertragen: Panik sells.

Karl Lauterbach ist daher natürlich am Donnerstag Abend bei Maybrit Illner im Studio. Aber damit nicht genug – man hat Illner förmlich umzingelt von „Experten“, von denen man ohne Corona nie etwas gehört hätte. Und die wollen natürlich verhindern, dass sie bald wieder in der medialen Versenkung verschwinden.

10.09.2021 18:56:57 [Telepolis]
IAA: Polizei geht mit großer Härte gegen Proteste vor
Es ist noch Postkartenwetter in München, aber nicht mehr lange. Schon jetzt hageln die Schlagstöcke. Und es gäbe auch Spaßiges von der Internationalen Automobil-Ausstellung (IAA) zu berichten, die ein Epochenbruch von Frankfurt nach München geführt hat, zu berichten.

Etwa die BR-Radio-News-Info von gestern, als ein Vertreter der Automobilbranche angesichts der Updatemöglichkeiten der zunehmen computerisierten Kfz frohlockte, dass die Autos damit künftig "immer frisch und neu sind". Wie ein Gemüsehändler aus den Postkarten-50-ern. Es soll ja auch Autofahrer geben, die an den Fehlermeldungs-Updates verzweifeln.

11.09.2021 07:05:12 [Nordbayern]
Impfpässe: Selten war Betrug einfacher
Der Kampf gegen die drohende Zwei-Klassen-Gesellschaft führt Timo Friese in die Kriminalität. "Das ist schon ein politischer Akt", sagt der junge Mann, der eigentlich anders heißt. Über "Kontakte" hat er sich einen gefälschten Impfpass besorgt. Eben jenes gelbe Heftchen, das bald zwischen Freiheit und kostenpflichtigen Tests steht, zwischen womöglich wieder einem Lockdown und dem Restaurantbesuch mit Freunden. "Die Gefahr, auf einen niedrigeren Status abzurutschen, ist für mich keine Option." Die Impfung aber eben auch nicht.
11.09.2021 07:15:48 [Migazin]
Afghanische Ortskräfte: Innenministerium verweigerte Bürokratie-Abbau über Monate
Wegen umständlicher bürokratischer Verfahren sind Tausende afghanische Ortskräfte deutscher Organisationen nicht rechtzeitig an ein Visum für Deutschland gekommen. Nach Informationen des „Evangelischen Pressedienstes“ gingen im Zeitraum von Anfang Juli bis Mitte August mehr als 9.000 Gefahrenanzeigen von Afghanen bei den zuständigen Stellen ein. Nach Abzug von Duplikaten waren es knapp 4.200. Doch bis zum vergangenen Montag, also einen Tag nach der Machtübernahme der Taliban, hatte das Bundesamt für Migration und Flüchtlinge (Bamf) der vorliegenden Statistik zufolge nur in 237 Fällen eine Berechtigung zur Visa-Ausstellung erteilt.
11.09.2021 12:05:33 [Der Freitag]
Karl Lauterbach: Er darf nicht Gesundheitsminister werden!
Es ist ein seltsamer Wahlkampf. Das wichtigste, alles dominierende politische Ereignis der letzten anderthalb Jahre spielt so gut wie keine Rolle. Lothar Wieler vom Robert-Koch-Institut warnt wie gewohnt mit breiter Sorgenfalte vor der nächsten Welle, die Kandidaten aber reden kaum über Corona. Nicht mal die FDP, die den „Maßnahmen“ der Bundesregierung kritisch gegenübersteht, stellt das Thema in den Mittelpunkt ihrer Kampagne. Und die ganz große Koalition, unter Einschluss der Grünen, war sich bei der Pandemiebekämpfung sowieso immer einig. Nur leise, eher hilflos regt sich Widerstand.
11.09.2021 12:27:06 [Kontext Wochenzeitung]
Abellio in Baden-Württtemberg: Fahrt ins Ungewisse
Seit zwei Jahren betreibt Abellio einige Bahnstrecken um Stuttgart, doch die Probleme hören nicht auf. Weil das Unternehmen nun tief in der Krise steckt, fürchten die Mitarbeiter um ihre Jobs und bitten den Staat um Unterstützung. "Ich habe mir Abellio vor fünf Jahren als Arbeitgeber ausgesucht“, sagt Jürgen Lapp. Bei Bahn-Mitarbeitenden habe das Unternehmen einen guten Ruf. Lapp ist Vorsitzender des Konzernbetriebsrats und der hat Ende August einen offenen Brief an die Landesregierungen der Bundesländer und an die Verkehrsverbünde geschrieben, für die das Unternehmen Eisenbahnlinien betreibt. Denn Abellio Deutschland ist in Schieflage geraten und hat sich seit 30. Juni in ein dreimonatiges Schutzschirmverfahren unter Aufsicht eines Sachwalters begeben. Das bedeutet, bis Ende September muss geklärt sein, wie es weiter geht.
11.09.2021 13:59:53 [TAZ]
Schwarz-Rot-Gelb in Magdeburg steht
Sachsen-Anhalt wird künftig von einer Koalition aus CDU, SPD und FDP regiert. Als letzte der drei Parteien stimmte am Freitagabend die FDP dem ausgehandelten Koalitionsvertrag zu: Ein außerordentlicher Landesparteitag sprach sich am Freitagabend bei einer Enthaltung und einer Gegenstimme für das Bündnis aus. Landes-Parteichefin Lydia Hüskens dankte den Delegierten für das klare Votum. CDU und SPD hatten der Koalition schon zugestimmt. Die FDP hatte bei der Landtagswahl am 6. Juni 6,4 Prozent der Stimmen bekommen und war nach zehn Jahren außerparlamentarischer Opposition in den Landtag zurückgekehrt.
11.09.2021 14:02:23 [Antifa-Infoblatt]
Rechter Waffenhandel: Die bayerisch-kroatische Connection
Die Generalstaatsanwaltschaft München ermittelt gegen 16 Personen wegen Verstößen gegen das Kriegswaffenkontrollgesetz und das Waffengesetz. Im Sommer 2020 waren in Bayern, Sachsen, Sachsen-­Anhalt und Österreich die Wohnungen und Büros der Beschuldigten durchsucht worden. Die Beschuldigten sind laut Staatsanwaltschaft "rechts eingestellt" oder als "Reichs­bürger" bekannt. Acht von ihnen sollen im Bereich der politisch motivierten Kriminalität aufgefallen sein.

Der Hauptbeschuldigte Alexander Reichl (Neubiberg) und fünf weitere Männer sollen mit den Waffen gehandelt haben, die anderen zehn Beschuldigten hatten wohl Interesse am Kauf signalisiert.

11.09.2021 14:26:29 [Junge Welt]
Faschistisches Pogrom: Startschuss zur Gewalt
Nachdem es nach der sogenannten Wiedervereinigung der Bundesrepublik und der DDR zu drastischen sozialen Verwerfungen und Desillusionierung gekommen war, brach sich zu Beginn der 1990er Jahre eine Welle rassistisch motivierter Gewalt Bahn. So kam es zwischen dem 17. und 23. September 1991 im sächsischen Hoyerswerda erstmalig zu über Tage hinweg anhaltenden rassistischen Pogromen, bei denen unter dem Jubel des Teils der Bevölkerung, der dem Angriff beiwohnten, ein Wohnheim für DDR-Vertragsarbeiter aus Vietnam und Mosambik sowie ein Flüchtlingswohnheim attackiert wurden.
11.09.2021 16:09:22 [Junge Welt]
Rechte Netzwerke: Neue »bewaffnete Gruppe«
In der Affäre um einen großangelegten Munitionsdiebstahl durch Spezialkräfte der sächsischen Polizei gibt es einem Untersuchungsbericht zufolge keine Belege für Verbindungen zu rechten Netzwerken. Der Expertenbericht nennt unter anderem »Mängel« in der Dienstaufsicht und der Personalstruktur als Gründe dafür, dass Beamte des Landeskriminalamts mindestens 7.000 Schuss Munition entwenden konnten, wie das sächsische Innenministerium am Freitag in Dresden mitteilte. Die Generalstaatsanwaltschaft ermittelt gegen 17 Polizeibeamte des mobilen Einsatzkommandos Dresden des LKA unter anderem wegen gemeinschaftlich begangenen Diebstahls und Verstoßes gegen das Waffengesetz.
11.09.2021 17:26:55 [Tichys Einblick]
Das Sündenregister des Olaf Scholz
Olaf Scholz wirkt immer ruhig und bedächtig, manchmal fast langweilig staatstragend. Sein unterkühlter hanseatischer Habitus wirkt vertrauenserweckend, zumal dann, wenn seine Konkurrenten um das Kanzleramt entweder als „Tolpatsch“, wie Armin Laschet inzwischen fast pauschal diskreditiert wird, oder als überambitioniert und überfordert wirken wie Annalena Baerbock. Das von der SPD-Wahlkampagne beförderte Bild vom kompetenten Kanzler Scholz zeigt Wirkung im Volk, wenn die Demoskopen das Stimmungsbild im Land korrekt abbilden.
11.09.2021 18:37:27 [Junge Welt]
Greenwashing in München
Direkt zu den Füßen der »Bavaria«, einer der bekanntesten Statuen Münchens, haben seit Anfang der Woche Klimaaktivisten ihre Zelte aufgeschlagen. Sie sind aus dem ganzen Bundesgebiet zusammengekommen, um gegen die Internationale Automobilausstellung (IAA) zu protestieren. Diese fand in den Jahren zuvor in Frankfurt am Main statt, nun ist zum ersten Mal München die Bühne für das, was Anna Meyer als »Propagandashow der Autokonzerne« bezeichnet. Meyer ist Pressesprecherin des Aktionsbündnisses »Smash IAA«, einem von mehreren Zusammenschlüssen, die gegen die Autoshow mobil machen.
11.09.2021 18:42:35 [Focus]
Als es um Quarantäne einer 4-Jährigen geht, droht SPD-Landrat den Eltern mit Gefängnis
Die Hoffnungen, die Corona-Pandemie überstanden zu haben, sinken in Deutschland spätestens, seit der Chef des Robert-Koch-Instituts Lothar Wieler und Bundesgesundheitsminister Jens Spahn in dieser Woche vor einer „fulminanten vierten Welle“ gewarnt haben. In den Fokus der Diskussion geraten dabei inzwischen auch Kinder unter zwölf Jahren, für die es einerseits derzeit noch keinen zugelassenen Impfstoff gibt, die aber andererseits auch extrem selten schwer erkranken.

Allerdings können sie als Träger des Virus durchaus andere anstecken – weswegen auch für sie in Deutschland derzeit rigide Quarantänemaßnahmen gelten.

11.09.2021 18:43:53 [Frankfurter Allgemeine Zeitung]
Tausende demonstrieren gegen steigende Mieten
Mehrere Tausend Menschen haben am Samstag in Berlin gegen hohe Mieten protestiert. Die Veranstalter sprachen von 20.000 Teilnehmern. Die Polizei schätzte die Zahl der Protestierenden am Nachmittag auf eine „höhere vierstellige Zahl“, wie ein Sprecher sagte. Aufgerufen zum Protest hatten das „Berliner Bündnis gegen Verdrängung und Mietenwahnsinn“, der Berliner Mieterverein und bundesweite Initiativen gegen hohe Mieten.

Ein Sprecher des Berliner Bündnisses forderte in seiner Rede, dass bundesweit alle Mietkonzerne enteignet werden müssten. Wohnraum dürfe nicht an die Börse. „Wir von unserem Aktionsbündnis fordern einen bundesweiten Mietendeckel von der neuen Bundesregierung.“

12.09.2021 07:23:07 [The Lower Class Magazine]
Für Umfragewerte über Leichen
Wenn er wollte, könnte Olaf Scholz auf sein dreiundzwanzigjähriges Politikerleben zurückblicken und es gut sein lassen. Zwar gibt es wenige konkrete Erfolge zu verzeichnen. Die buzzwordgeladene Pseudobegeisterung der SPD-Wahlkämpfer ist der beste Beweis dafür. Aber die eigene Karriere mit hohen Posten schmücken konnte Scholz schon immer – wenn auch meistens als Lückenfüller für einen scheidenden Vorgänger.

Kritik gibt es meist nur schlagwortartig, um in der Kürze überhaupt alle relevanten Verfehlungen unterzubekommen. Von Brechmittel bis Wirecard wird hier zusammengetragen, was den Kanzlerkandidaten der Sozialdemokraten zu einer der umstrittensten Figuren seiner Partei macht.

12.09.2021 09:42:55 [Tichys Einblick]
Im Wahlkampf fallen die Masken
Für Kanzlerkandidaten gelten keine Corona-Regeln. Sie sind gleicher als gleich.
SPD-Kanzlerkandidat Olaf Scholz (Double-Income no Kids) macht Wahlkampf mit Kindern in einer Berliner Schulklasse – obendrein noch für eine TV-Show „Kannste Kanzleramt“. Aber nicht nur er, sondern auch seine Mitbewerber Annalena Baerbock (Grüne) und Armin Laschet (CDU) sind mit von der Partie.

Bild berichtet über diese politische Extratour mit der Schlagzeile: „Schüler kriegen Maskenfrei“ Wie das auf einmal und warum? Weil in gut zwei Bundestagswahl ist! Da gibt es plötzlich Freiheiten für die drei Kandidaten von SPD, Grünen und CDU.

12.09.2021 11:54:18 [Reitschuster]
Bundespressekonferenz schafft sich ab
Die Bundespressekonferenz war eine der ersten bundesdeutschen Nichtregierungsorganisationen (NGO), die sich einen Namen gegeben hat, der beim Bürger bis heute so klingt, als handle es sich um eine staatliche Organisation. Ähnlich erfolgreich sind beispielsweise die Landesflüchtlingsräte, jeweils mit dem Bundesland im Namen vorangestellt.

Der eingetragene Verein „Bundespressekonferenz“ ist eine Organisation von Journalisten mit festem Haus in der unmittelbaren Nähe zur Bundesregierung, aber ursprünglich nicht regierungsnah angelegt. Hier werden Regierungsvertreter oder ihre Sprecher eingeladen, auf Fragen Antwort zu geben.

12.09.2021 15:44:54 [Reitschuster]
Staatliche Erpressung von Ungeimpften?
Entsprechende Gesetzesänderung erfolgte bereits vor anderthalb Jahren. Manche Dinge sind so ungeheuerlich, dass sie einem gar nicht sofort auffallen. Und offenbar geht es vielen so. „Ungeimpft in Quarantäne: Ab September keine Entschädigung mehr“ – unter diesem Titel schrieb Alexander Wallasch hier vor einigen Tage darüber, dass in Baden-Württemberg Ungeimpfte keine Lohnfortzahlung mehr bekommen, wenn sie in Hausarrest (neudeutsch „in Absonderung“) müssen, weil sie Kontakt zu einem positiv Getesteten hatten. Ein unglaublicher Vorgang. Bei mir läuteten zwar die Alarmglocken – aber nicht so laut, wie sie es hätten tun müssen.
12.09.2021 15:55:03 [RT DE]
„Ich werde von Jens bezahlt“
Über eine Edel-Impfärztin und Verbalschlachten am Bukephalos-Gymnasium. Die Corona-Malaise mutiert zu einer hochgefährlichen gesellschaftlichen Krise, die möglicherweise höhere Risiken als die rein medizinische Bewährungsprobe birgt. Dies wird exemplarisch an den zunehmend schärfer werdenden Auseinandersetzungen an deutschen Schulen deutlich. Ein impressionistischer Lagebericht des Experten für strategische Führung und RT-Kolumnisten Prof. Dr. Kai-Alexander Schlevogt. Verbale Saalschlacht am Bukephalos-Gymnasium: Wenn sogar Orgelpfeifen erröten

Mit einem Höllentempo nähert sich Deutschland wieder düsteren Zeiten von Schlachten in Sälen und Hallen.

12.09.2021 17:22:05 [Telepolis]
Laut Michael Müller (SPD) sind Ungeimpfte jetzt schon ein "Risiko"
Mit Druck und Anreizen wollen Bund und Länder vor dem Herbst die Impfquote noch nach oben drücken. Obwohl fraglich ist, wie groß deren Mobilisierungspotenzial ist, soll dabei nun auch die Deutsche Bischofskonferenz helfen: Sie ruft mit der Bundesregierung zusammen im Rahmen der Kampagne #HierWirdGeimpft zur Immunisierung gegen den Corona-Virus Sars-CoV-2 auf.

Zugleich erhöhen einzelne Länderregierungen den Druck auf Ungeimpfte deutlich. Allgegenwärtig ist die optionale Einführung der sogenannten 2-G-Regel.

12.09.2021 19:06:04 [Egon W. Kreutzer]
Der gute Onkel Gauck
Eine kleine stilistische Fingerübung in "einfacher Sprache". Vordergündig lustig - bei näherem Hinsehen aber sehr ernst gemeint. Herr Joachim Gauck ist einer von den Guten. Das sieht man ihm an.
Er hat eine nette, knubbelige Nase. Er hat lustige Äuglein und volles Haar.
Das hat er nicht selbst gesagt, weil man es sehen kann.



Herr Joachim Gauck spricht gerne in einfacher Sprache.
Das hat er als Pastor gelernt. Pastor ist jemand, der den Leuten sagen kann, was der liebe Gott will. Dazu muss man lange in der Bibel lesen. Dann kennt man die Wahrheit. In der einfachen Sprache wird auch das Denken einfach. Die einfache Sprache teilt die Menschen immer nur in zwei Gruppen.

13.09.2021 13:32:33 [Neues Deutschland]
CDU geht angeknockt aus dem Ring
Zum gegenseitigen Rededuell mit sich abwechselnden Paarungen haben sich am Samstagabend vier bereits im Bundestag gestandene Größen in Rendsburg eingefunden: Johann Wadephul, stellvertretender Fraktionsvorsitzender der CDU, Marco Buschmann, Parlamentarischer Geschäftsführer der FDP-Fraktion, Konstantin von Notz, stellvertretender Vorsitzender in der Grünen-Fraktion sowie Dietmar Bartsch als Fraktionsvorsitzender der Linken und deren Spitzenkandidat. Zusammengestellt hat die Viererrunde das Institut für Bildungsdienstleistung (IfB). Zu einer Verwicklung kam es schon im Vorfeld der Veranstaltung.
13.09.2021 13:35:30 [Junge Welt]
Geschichtsstunde mit Laschet
Er habe »geliefert«, konstatierte das Nachrichtenportal tagesschau.de am Sonnabend: CDU-Kanzlerkandidat Armin Laschet habe auf dem CSU-Parteitag in Nürnberg eine »für seine Verhältnisse wirklich gute, kämpferische Rede« gehalten. Die Süddeutsche Zeitung (SZ) fand dagegen vor allem die Angriffe Laschets auf die SPD »ziemlich zweifelhaft, vorsichtig ausgedrückt«. So unterschiedlich beurteilten Leitmedien den Auftritt des CDU-Vorsitzenden bei der Schwesterpartei, durch den zwei Wochen vor der Bundestagswahl das Ruder noch herumgerissen werden sollte.

Die Kritik der SZ bezog sich vor allem auf einen Satz, der auch von anderen Medien und von Politikern kritisiert wurde.

13.09.2021 13:56:45 [Tichys Einblick]
Corona-Sonderrecht öffnet den Weg zur Risiko-Krankenversicherung
Eine Impfpflicht wird es nicht geben. Aber der Zwang zu einer Corona-Risikoversicherung für „Impfverweigerer“ wird viele Menschen sofort in Jubel ausbrechen lassen – ohne zu bemerken, dass sie mit ihrem eigenen Verhalten auch unzählige Anlässe bieten, sich künftig mit Risiko-KV zusätzlich versichern lassen zu müssen. Wofür Corona nicht alles gut ist. Nun geht es also an den Umbau der Krankenversicherung – eines der heiligsten Güter unserer Republik. Und jene, die seit eh der Nähe vor allem zur Sozialdemokratie unverdächtig sind und sich als Vertreter der Arbeitnehmerschaft verkaufen, protestieren bestenfalls verhalten, während der Möchtegern-Kanzler der SPD um das Thema Arbeitnehmerrechte in diesem Fall einen großen Bogen macht.
13.09.2021 17:20:54 [Telepolis]
Corona: Impf-Aktionswoche mit Fragezeichen
Im Zuge der neuen Corona-Impfkampagne hat nun auch Bundesbildungsministerin Anja Karliczek (CDU) die Bevölkerung aufgerufen, sich eines der in der EU zugelassenen Vakzine verabreichen zu lassen. Nach Angaben der Bundesregierung sind bislang 62,2 Prozent der Bevölkerung vollständig geimpft. Führend bei der Impfkampagne sind Bremen (76,8 Prozent) und das Saarland (72,5 Prozent), die Schlusslichter bilden Sachsen (56,2 Prozent) und Thüringen (59 Prozent).

Die Bundesregierung setzt in dieser Situation weiterhin auf die Durchimpfung der Bevölkerung - und befindet sich damit im europäischen Trend.

14.09.2021 09:26:45 [Analyse & Kritik]
Bitte nicht grün umlackieren
Bei der IAA in München rangen Klimaaktivisten und Autohersteller um Aufmerksamkeit und den öffentlichen Raum – eine Bilanz der Protestwoche: Zwei Polizisten klettern auf einen Holzzaun, die Latten brechen, sie fallen zu Boden. Sie stehen wieder auf und schließen sich der Reihe der gegenüber stehenden Polizisten an. Zwischen dem kaputten Holzzaun und den behelmten Beamte stehen zwei Bäume, darauf sitzen zwei Aktivisten. Unten drängen sich Demonstranten in weißen Maleranzügen, sie schreien. Mit Pfefferspray und Schlagstöcken drängt die Polizei die Demonstrierenden zurück. Auch zwei Journalisten bekommen Pfeffer ab. Nach etwa einer Viertelstunde zieht sich die Polizei zurück.
14.09.2021 11:31:08 [Reitschuster]
Ein Taschenspielertrick von Spahn?
Bei zahlreichen Gelegenheiten geht Bundesgesundheitsminister Jens Spahn mit einer Zahl hausieren, die beeindruckend klingt: 95 Prozent der COVID-19-Patienten auf den Intensivstationen seien ungeimpft, so der Christdemokrat. Unter anderem antwortete er damit vergangene Woche auf meine Frage bei der Bundespressekonferenz, ob es nicht irreführend sei, die Inzidenz von Ungeimpften, die sich ständig testen lassen müssen, mit der vom Geimpften zu vergleichen, die kaum getestet werden. In einem Youtube-Video stellt ein Student die Zahlen in Frage – mit einer Begründung, die zumindest auf den ersten Blick nicht ganz von der Hand zu weisen ist.
14.09.2021 16:49:28 [Der Freitag]
Olaf Scholz, ein Linkskanzler?
CDU und CSU sehnen sich nach Lagerwahlkampf, doch sie sollten gewarnt sein: Rote-Socken-Kampagnen waren schon immer Rohrkrepierer. In Gefahr und größter Not bringt der Mittelweg den Tod. Diesen genialen Filmtitel Alexander Kluges nimmt sich die Union jetzt zu Herzen und packt die ganz große Keule aus. Fraktionschef Ralph Brinkhaus: „Wir müssen … die Frage aufwerfen, was dem Land droht: ein linkes Bündnis. Am Ende ist es ein Lagerwahlkampf: Laschet oder ein Linkskanzler.“ Das ist Wasser auf die Mühlen von FDP-Chef Christian Lindner. Der kann diesen Wunsch nur nicht so laut aussprechen, weil er noch bis zum Wahltag von allen heiß begehrt werden möchte.
15.09.2021 09:30:09 [Reitschuster]
Ungeimpfte von Geimpften trennen
Hessen und weitere Länder schreiten voran, andere werden folgen: Es geht um die separate Ausweisung der 7-Tage-Inzidenz für Geimpfte bzw. Ungeimpfte. Die Gemengelage an Halbwissen, Täuschung und Unvernunft könnte kaum größer sein. So sagte der hessische Sozialminister Kai Klose in diesem Zusammenhang: „Diese Zahlen belegen eindrücklich, wie wirksam die Impfung ist. Es infizieren sich weit überwiegend Ungeimpfte.“

Das allerdings würde voraussetzen, dass Geimpfte im selben Maße getestet würden, was aber wiederum die 3G-Regel außer Kraft setzen würde, wo lediglich Nichtgeimpfte einen Testnachweis vorzeigen müssen.

15.09.2021 09:40:56 [Junge Welt]
Linke vor Bundestagswahl: Willig und bereit
Auf der Zielgeraden des Bundestagswahlkampfes verstärkt das Führungspersonal der Partei Die Linke das Werben um SPD und Bündnis 90/Die Grünen. Janine Wissler, Kovorsitzende und Spitzenkandidatin der Partei, warf am Dienstag gegenüber der Nachrichtenagentur dpa der Union vor, mit ihren Warnungen vor einem »rot-grün-roten« Regierungsbündnis »absurde Ängste zu schüren«. Sie erklärte, wenn SPD und Grüne ihre Wahlversprechen ernst meinten, »sollten sie sich nicht an die FDP ranwanzen, sondern zumindest mit uns darüber reden, was man gemeinsam machen kann«.
15.09.2021 17:11:26 [NachDenkSeiten]
Koalitionen und die Kriegsfrage: Bekenntnisse zum (Selbst-)Mord
Die Meinungsmache gegen die LINKE und ihre wichtigen friedenspolitischen Positionen geht weiter. Doch sie kommt nicht nur in Form einer neuen „Rote-Socken-Kampagne“ von der CDU, sondern (unter anderem als Reaktion darauf) auch von SPD und Grünen. Tobias Pflüger von der LINKEN hat nun auf die Forderungen zum „NATO-Bekenntnis“ durch Olaf Scholz oder Annalena Baerbock geantwortet. Die Friedensbewegung hat nicht mehr den Einfluss, der für die Abwendung von Zukunftsgefahren nötig ist. Deshalb können die Bündnisgrünen und die SPD ohne nennenswerten öffentlichen Protest verlangen, dass die LINKE ein ‚Bekenntnis‘ zur Nato abgeben muss, wenn sie in die Regierung mit aufgenommen werden soll.
15.09.2021 19:01:42 [Reitschuster]
ZDF-Schlagabtausch: Opposition prügelt sich – Regierung duckt sich weg
Damit es nicht ganz so peinlich parteiisch aussieht, dürfen sich die vermeintlich Kleinen auch im öffentlich-rechtlichen Fernsehen präsentieren, erst im ZDF, später ARD. Nein, nicht am Sonntagabend. Nein, nicht drei mal hintereinander zwei Stunden lang, dafür gewissermaßen als Kickoff eine knappe Stunde am Montag im ZDF schon ab 19 Uhr.

Die Grünen gehören nicht mehr zu den Kleinen, sie wurden über Jahre auf Kosten des Zwangsgebührenzahlers in die Zweistelligkeit und in die Kanzlerkandidatur subventioniert.

16.09.2021 06:58:11 [Migazin]
Stell dir vor, es ist Krieg, und niemand berichtet.
Das Außenministerium hat versagt, ebenso das Innen- und Verteidigungsministerium - Merkel sowieso. Aber auch die Medien haben versagt: In Afghanistan war 20 Jahre Krieg und niemand hat berichtet. Vor Wochen habe ich hier bereits über Afghanistan geschrieben; darüber, dass Horst Seehofer weiter Menschen dorthin abschieben wollte, obwohl Afghanistan und Kabul in Kürze unweigerlich fallen würden. Zu diesem Zeitpunkt war das, auch ohne Geheimdienstberichte, die mir tagtäglich auf den Tisch gelegt würden, für mich eine Selbstverständlichkeit. Selbst die Taliban haben Berichten zufolge aber nicht damit gerechnet oder geplant, Kabul so schnell einzunehmen.
16.09.2021 07:17:03 [Telepolis]
Folgen der Pandemie-Politik für Kinder im Visier
Die Bundesregierung will untersuchen lassen, wie sich der Betrieb von Schulen auf die Pandemie ausgewirkt hat. Das geht aus einem Bericht des Gesundheits- und des Familienministeriums hervor. Darin heißt es: "Die Bundesregierung strebt an, eine mit der Corona-Kita-Studie vergleichbare Untersuchung für den Schulbereich aufzulegen". Das Thema stand am Mittwoch auf der Tagesordnung des Bundeskabinetts

In dem 20-seitigen Bericht haben Mitarbeiter beider Ministerien mithilfe von Experten die bisher erfassbaren gesundheitlichen Auswirkungen der Corona-Politik auf Kinder und Jugendliche beschrieben.

 Aktuelle Themen (65)
01.09.2021 06:55:42 [Blickpunkt WiSo]
DGB-Aufruf: Weichen für eine sichere und friedliche Zukunft stellen!
Seit 1957 erinnern auch die deutschen Gewerkschaften am 1. September an die Schrecken von Krieg, Gewalt und Faschismus. Wir dokumentieren den Aufruf des DGB zum Antikriegstag 2021. Für uns Gewerkschaften ist der Antikriegstag ein besonderer Tag der Mahnung: Nie wieder Krieg! Nie wieder Faschismus! Er ist für uns ein Tag des Erinnerns daran, dass Deutschland angesichts der Menschheitsverbrechen der Nazis besondere Verantwortung für den Frieden trägt. Für uns steht fest: Wenn wir künftig friedlich und sicher zusammenleben

wollen, brauchen wir eine Politik, die auf Abrüstung und Entspannung setzt, statt auf Aufrüstung und Abschreckung.

01.09.2021 08:58:46 [TAZ]
Lobbyismus in der EU: Schlacht der Internetinteressen
Big Tech schlägt Big Pharma: Wenn es ums Lobbying in Brüssel geht, dann sind Amazon, Face­book, Google & Co. nicht mehr zu toppen. Satte 97 Millionen Euro bringen die Tech-Giganten jährlich für ihre Interessenvertretung auf, wie eine Studie der Nichtregierungsorganisationen LobbyControl und Corporate Europe Observatory enthüllt. Die zehn größten Digitalkonzerne beschäftigen über 140 Lobbyisten in der Hauptstadt der Europäischen Union.

Die gut bezahlten Interessenvertreter bereiten sich auf die wohl größte Lobbyschlacht aller Zeiten vor. Die EU will das Internet regulieren und die Macht der „Gatekeeper“ begrenzen.

01.09.2021 09:17:55 [Junge Welt]
Tödliches Geschäft: Mit Wumms aus der Krise
Vor dem Weltfriedenstag verkündet Heckler & Koch Profitsteigerung. Alle 14 Minuten stirbt ein Mensch durch eine Waffe des Konzerns. Für die Produzenten von Kriegswaffen laufen die Geschäfte 82 Jahre nach dem Überfall der Nazis auf Polen am 1. September 1939 wie geschmiert. Wie das deutsche Traditionsunternehmen Heckler und Koch (H & K) auf seiner digitalen Hauptversammlung am Dienstag – ausgerechnet vor dem Weltfriedenstag – stolz verkündete, konnte es trotz coronabedingt schwieriger Umstände 2020 nach langjähriger Flaute das beste Geschäftsjahr verzeichnen. Der Umsatz stieg im letzten Jahr um rund 15 Prozent auf 275 Millionen Euro.
01.09.2021 11:17:28 [NachDenkSeiten]
Evakuierung in Afghanistan: Die Regierung belügt die Öffentlichkeit
Das Drama in Afghanistan geht weiter. Ortskräfte, die für deutsche Stiftungen oder die EU-Kommission gearbeitet haben, fürchten um ihr Leben, weil sie nicht aus Afghanistan rauskommen. Axel Kühne, der 2004 als Techniker in Afghanistan war und mit dem Land und seinen Menschen weiterhin verbunden ist, hat sich mit einer privat organisierten, internationalen Gruppe von Personen, die in Afghanistan tätig waren, zusammengeschlossen, die gut vernetzt auf privater Basis versucht, Ortskräfte aus dem Land zu holen. Im NachDenkSeiten-Interview kritisiert er die Bundesregierung scharf.
01.09.2021 12:46:46 [Junge Welt]
Antikriegstag: Nötiger denn je
Zum Antikriegstag auf die Straßen: Aggressives Militärbündnis, horrende Rüstungsausgaben und fehlende politische Gegenwehr. Nicht erst seit 1957 gehen jene, die für Frieden und eine kriegsbefreite Welt kämpfen, auf die Straße. Aber seit 64 Jahren ist der 1. September – der Tag, an dem Nazideutschland 1939 in Polen einfiel und den Zweiten Weltkrieg entfesselte – in der BRD bei Gewerkschaften und Friedensbewegung als Antikriegstag gesetzt, um anhaltende kriegerische Zerstörung, Gewalt und Faschismus anzuprangern und der zahllosen Opfer zu gedenken.
01.09.2021 14:31:12 [Telepolis]
Nato und Ukraine: Erdgas aus Russland oder Krieg mit Russland?
Im Streit um die Gaspipeline Nord Stream 2 versucht sich die ukrainische Führung weiterhin in eine günstigere Position gegenüber Russland zu bringen. Nachdem Bundeskanzlerin Angela Merkel das energiepolitische Vorhaben vor gut einem Monat in Washington verteidigt und zugleich deutliche Worte an Moskau gerichtet hat, ist der Regierung in Kiew offenbar klargeworden, dass sich Nord Stream 2 nicht mehr verhindern lässt.

So versucht Präsident Wolodimir Selenski nun das Beste für sein Land auszuhandeln.

01.09.2021 15:44:50 [Junge Welt]
Giganten der Hightechindustrie: Google macht Politik
In ihrem Tagesgeschäft sind es die Köpfe von Milliarden Konsumenten, in die Bigtech-Konzerne wie Google, Facebook oder Amazon vordringen, um darin verborgene Denk-, Gefühls- und Verhaltensmuster gewinnbringend zu verwerten. Mindestens genausowichtig ist jedoch der Zugriff auf die Köpfe der Entscheider, die dafür ihren Segen geben – oder auch nicht. Die IT- und Plattformindustrie unterhält ein ganzes Heer an Lobbyisten nur zu dem Zweck, die gesetzgebenden Institutionen auf nationaler und internationaler Ebene auf Linie zu bringen bzw. zu halten. Welches Ausmaß die politische Landschaftspflege allein innerhalb der Europäischen Union (EU) angenommen hat, offenbart eine am Montag vom Verein Lobbycontrol und der Initiative Corporate Europe Observatory (CEO) vorgelegte Studie.
01.09.2021 15:54:02 [Telepolis]
Darf der Boss wissen, wer geimpft ist?
Die aktuelle Debatte um den Impfstatus für Beschäftigte und die Arbeitergesundheitsbewegung. Immer mehr öffentliche Einrichtungen gewähren Zutritt nur für Genesene und Geimpfte. Da ist es nicht verwunderlich, wenn jetzt auch darüber diskutiert wird, dass Unternehmer das Recht bekommen, ihre Mitarbeiter nach dem Corona-Impfstatus zu fragen. Bisher ist das gesetzlich nicht möglich. Bisher gilt eine Befragung nach dem Impfstatus als Datenerhebung und da sind recht strenge Grenzen gesetzt. Manche wollen diese in Zeiten von Corona aufweichen.


01.09.2021 17:46:55 [RT DE]
Warum der 1. September als "Weltfriedenstag" wichtig bleibt
Es ist der 1. September. Als Kind lernte ich in der DDR, das sei der "Weltfriedenstag". Damit sollte nämlich an den Beginn des 2. Weltkrieges durch den heimtückischen deutschen Überfall auf Polen erinnert werden. Das Land, in dem der Tag der "Weltfriedenstag" war, ist ohne Krieg verschwunden. In der seit fast 31 Jahren umso größeren Bundesrepublik wird der 1. September "Antikriegstag" genannt.

In diesem Jahr erinnern Friedensgruppen und Gewerkschaften an diesen Tag, haben Aufrufe dazu veröffentlicht und lokale Aktionen angekündigt. "Für uns Gewerkschaften ist der Antikriegstag ein besonderer Tag der Mahnung: Nie wieder Krieg! Nie wieder Faschismus!", so der Deutsche Gewerkschaftsbund (DGB).

01.09.2021 19:36:22 [Net News Express]
Redaktionspause auf NNE vom 2.9.2021 bis einschließlich 5.9.2021
Liebe Leserinnen und Leser, wie in den vergangenen Wochen bereits angekündigt, legen wir ab Donnerstag, den 2.9.2021 bis einschließlich Sonntag, den 5.9.2021 eine kurze Redaktionspause ein. Wir bitten um Ihr Verständnis. Am Montag, den 6.9.2021 geht es wieder weiter. Bitte beachten Sie auch unseren gelben Mitteilungskasten auf der rechten Seite. Beste Grüße, Julie Kreutzer
06.09.2021 07:24:19 [Junge Welt]
»Unteilbar«-Demonstration in Berlin: 30.000 auf der Straße
Es war wie ein großer Abgesang auf die Amtszeit von CDU-Kanzlerin Angela Merkel. Für eine solidarische Gesellschaft gingen am Sonnabend nachmittag Zehntausende Menschen in Berlin auf die Straße. Sie protestierten gegen den Umgang der Politik mit dem Klimawandel und anhaltenden Krisen wie der im Gesundheitswesen, gegen die Abschottung der EU und den eskalierenden »Mietenwahnsinn«. Sie folgten damit dem Aufruf des aus mehr als 350 Zusammenschlüssen bestehenden »Unteilbar«-Bündnisses. Unter Einhaltung geltender Hygienebestimmungen zog die Demonstration von der Straße des 17. Juni durch das Zentrum der Bundeshauptstadt.
06.09.2021 09:20:02 [Telepolis]
#Unerfolgreich
Die jüngste Demonstration des Unteilbar-Bündnisses in Berlin ist gefloppt, aber niemand will darüber reden. Am Ende kann man es drehen und wenden, wie man will: Die jüngste Demonstration des "Unteilbar"-Bündnisses kann nur als Ausdruck einer schwindenden Mobilisierungsfähigkeit der Zivilgesellschaft verstanden werden. Gerade einmal 10.000 Menschen kamen nach Angaben der Polizei in die Bundeshauptstadt, auch wenn die Veranstalter 30.000 – und damit die anvisierte Teilnehmerzahl – gezählt haben wollen.

Nehmen wir den Mittelwert von 20.000 Teilnehmern und teilen Sie durch die 350 Aufrufer, unter ihnen Massenorganisationen wie der Deutsche Gewerkschaftsbund, so hat jede Organisation im Schnitt 57 Menschen auf die Straße gebracht.

06.09.2021 11:49:09 [German Foreign Policy]
Korruption am Niedriglohnstandort
Mit starkem Unmut reagiert Berlin auf Korruptionsvorwürfe gegen einen Kooperationspartner der deutschen Entwicklungshilfe in Tunesien. Präsident Kaïs Saïed, der Ende Juli die fast alleinige Macht in Tunis an sich gerissen hat, dabei jedoch die überwältigende Zustimmung der Bevölkerung genießt, wirft jetzt der Antikorruptionsbehörde des Landes vor, selbst bestechlich zu sein. Mit der Behörde arbeitet die deutsche Entwicklungsagentur GIZ eng zusammen. "Wir erwarten", wird ein deutscher Diplomat zitiert, dass Saïed - unabhängig von der Haltung der Bevölkerung - "einen Fahrplan" zur Wiedereinsetzung aller entmachteten Amtsträger vorlege.
06.09.2021 13:26:56 [Junge Welt]
Arbeitskampf bei Bahn ausgeweitet
Die Gewerkschaft Deutscher Lokführergewerkschaft (GDL) hat ihre Streiks auch am Wochenende fortgesetzt. Laut einer Bahn-Sprecherin beteiligten sich seit Beginn des Streiks am Mittwoch nachmittag bis einschließlich Sonntag morgen insgesamt mehr als 9.760 Beschäftigte an dem Arbeitskampf.

Den Streikenden in den Rücken fiel ausgerechnet der Vorsitzende des Deutschen Gewerkschaftsbunds, Reiner Hoffmann. Er kritisierte, »dass hier eine Berufsgruppe wie die Lokführer ihre partikularen Interessen gegen das Gesamtinteresse aller anderen Bahn-Beschäftigten durchsetzt«.

06.09.2021 17:11:52 [Junge Welt]
Linke vor Bundestagswahl: Alles verhandelbar
Vom Sterbefall zum Shooting-Star – vor der Bundestagswahl ist die SPD in den Umfragen, wo sie bei Werten von um 15 Prozent wie festgeleimt schien, in wenigen Wochen um zehn Prozentpunkte auf aktuell 25 Prozent hochgeschnellt. Rechnerisch würde es derzeit für »Rot-Rot-Grün« reichen. Die Führung der Partei Die Linke, die sich in den erwähnten Umfragen weiter in bedenklicher Nähe der Fünfprozenthürde bewegt, animierte das am Wochenende zu neuerlichem Werben um die Gunst der Sozialdemokraten. »Das Fenster ist so weit geöffnet wie noch nie«, erklärte die Kovorsitzende Susanne Hennig-Wellsow der "Frankfurter Allgemeinen Sonntagszeitung" (FAS) mit Blick auf eine Koalition mit SPD und Bündnis 90/Die Grünen.
06.09.2021 18:48:01 [RT DE]
"Trauerspiel Afghanistan": Zweiter Akt
Der Wertewesten führt seinen terroristischen Kolonialkrieg weiter, nur mit anderen Mitteln. Ist es Ihnen auch aufgefallen? Die Bundeswehr stellte in Afghanistan 20 Jahre lang eine Besatzertruppe von durchschnittlich 2.500 Soldaten. Nun sollen 40.000 Ortskräfte gerettet werden, also pro Bundeswehrsoldat circa 17 "Hiwis". Der Höchststand betrug vor zehn Jahren 5.433 Soldaten, und im März 2021 waren es noch knapp 1.100. Doch jetzt müssen, laut Außenminister Maas und Tagesschau, "mehr als 40.000 afghanische Ortskräfte der Bundeswehr" aus ihrem Heimatland heraus- und nach Deutschland in Sicherheit gebracht werden. Dass das pro Bundeswehrsoldat circa 17 Ortskräfte wären, fanden die ARD-aktuell-Hofberichterstatter keiner Nachfrage wert.
07.09.2021 09:30:59 [Netzpolitik]
Kritik am Prozess gegen den Produzenten des Ibiza-Videos
Anlässlich der Prozesseröffnung am Mittwoch gegen den an der Produktion des Ibiza-Videos beteiligten Julian Hessenthaler zeigen sich mehrere Menschenrechtsorganisationen und Journalistenverbände besorgt. Sie kritisieren in einer gemeinsamen Pressemitteilung eine „ausufernde“ Strafverfolgung und sind der Ansicht, dass der Umgang mit Hessenthaler ganz bewusst einen abschreckenden Effekt auf zukünftige Aufdecker und die Ausübung der Meinungs-, Presse- und Informationsfreiheit in Österreich haben könnte. Hessenthaler sitzt seit Ende 2020 in Haft, ihm werden Drogen- und Urkundendelikte vorgeworfen.
07.09.2021 09:32:26 [Junge Welt]
Autokapitalismus: Der Lack ist ab
Das einst propagierte liebste Kind der Deutschen ist bestenfalls noch ein Sorgenkind angesichts der sich anbahnenden Klimakatastrophe. Ausgerechnet im chronisch stauverstopften München wird am Dienstag die erste große Messe seit Frühjahr 2020, dem Beginn der Coronapandemie, eröffnet: die Internationale Automobil-Ausstellung (IAA). Nach spektakulären Blockadeaktionen durch Umweltschützer 2019 in Frankfurt am Main ist die einwöchige PS-Protzschau in die bayerische Landeshauptstadt umgezogen. Ihr wurde ein grüner Anstrich verpasst: IAA Mobility heißt sie jetzt und wirbt vornehmlich mit Fahrrädern und elektrisch angetriebenen Tretrollern auf ihrer Website.
07.09.2021 11:39:32 [Telepolis]
"Wir machen die IAA zum Desaster": Automesse ruft Protest auf den Plan
Raumgreifend, wie die Automobilismus schon lange ist, soll in diesem Jahr auch die Internationale Automobilausstellung (IAA) werden: Nach 70 Jahren in Frankfurt am Main findet sie vom 7. bis zum 12. September erstmals in München statt - und zwar nicht nur in Messehallen, sondern auch auf zentralen Plätzen im gesamten Innenstadtgebiet. Shows und Konzerte auf dem Königsplatz sowie eine "Kids-World" auf dem Marstallplatz sollen das Spektakel für die ganze Familie unvergesslich machen.

So werden zwangsläufig nicht nur Autofans mit der Messe konfrontiert, die sich inzwischen IAA Mobility nennt.

07.09.2021 13:47:36 [German Foreign Policy]
Der „Datenkontinent Nummer eins“
Mit milliardenschweren Investitionen und einer massiven Lobbyoffensive gehen Google und andere US-Internetkonzerne gegen Pläne Berlins und der EU zur Regulierung des EU-Digitalsektors vor. Google hat angekündigt, eine Milliarde Euro in zwei neue Rechenzentren in Deutschland zu investieren. Zudem geben das Unternehmen sowie weitere Firmen der US-Digitalbranche in Europa insgesamt fast 100 Millionen Euro für Lobbyaktivitäten aus; Google, Facebook und Microsoft sind die drei größten Lobbyisten überhaupt in Brüssel. Die EU-Regulierungspläne zielen insbesondere darauf ab, die Marktmacht der dominanten US-Konzerne zu brechen, um den Aufbau einer eigenständigen EU-Digitalbranche zu ermöglichen.
07.09.2021 18:51:08 [Tagesschau]
Spionage-Software: BKA soll Seehofer nicht informiert haben
Es war eine ungewöhnliche Sitzung des Innenausschusses, die am Dienstagmorgen im Deutschen Bundestag stattfand. Sie wurde als "geheim" eingestuft, und das hat mit der Thematik zu tun, um die es ging. Die Bundesregierung sollte den Abgeordneten berichten, ob deutsche Sicherheitsbehörden die umstrittene Spionagesoftware "Pegasus" des israelischen Unternehmens NSO einsetzen. Mit dem Trojaner können Smartphones umfangreich ausspioniert werden, sogar verschlüsselte Kommunikation kann man damit überwachen.

Bislang hatten die Regierung und die Behörden nahezu jede Auskunft dazu verweigert.

07.09.2021 18:52:58 [Telepolis]
Corona an den Schulen: Wissenschaft und Angst
Gestern haben sich die Gesundheitsminister der Länder auf eine bundesweit einheitliche Regelung für den Umgang der Corona-Pandemie an Schulen ausgesprochen. Die wichtigste Neuerung besteht in der Lockerung der Quarantäneregelungen.

Bei einem Quarantänefall in einer Schulklasse müssen künftig nicht mehr die ganze Gruppe oder Klasse, sondern nur noch die Nachbarn des Betroffenen in Quarantäne. Es gehe darum, möglichst viel Präsenzunterricht zu gewährleisten, begründete der bayerische Gesundheitsminister Klaus Holetschek, der aktuell als Vorsitzender der Gesundheitsministerkonferenz fungiert, die Lockerungen.

08.09.2021 07:06:03 [Junge Welt]
Militarisierung: Kriegszentrale Ulm
Begleitet von Protesten zelebriert die NATO am Mittwoch in Ulm die volle Einsatzfähigkeit ihres neuen Hauptquartiers JSEC (Joint Support and Enabling Command) in der Ulmer Wilhelmsburgkaserne. Aufgabe des Hauptquartiers ist es, die Verlegung von NATO-Truppen und Material im gesamten europäischen Bündnisgebiet zu koordinieren. »Wir sorgen dafür, dass militärische Kräfte in der richtigen Stärke mit der richtigen Ausrüstung zur richtigen Zeit am richtigen Ort sind« – so hat Generalleutnant Jürgen Knappe, Kommandeur des JSEC, dessen Funktion kürzlich zusammengefasst. Faktisch geht es vor allem darum, den schnellstmöglichen Aufmarsch des westlichen Kriegsbündnisses Richtung Russland vorzubereiten.
08.09.2021 11:32:01 [Junge Welt]
Putsch in Guinea: Vertrauen in Umsturz
Die Analogie zum Nachbarland Mali lässt sich nach dem Putsch in Guinea nicht von der Hand weisen. Eine militärisch präzise durchgeführte Absetzung eines unpopulären Staatschefs, von der Bevölkerung gefeiert und von der Opposition (zunächst) begrüßt. Nachdem der Anführer des Umsturzes, Mamady Doumbouya, am Sonntag verkündet hatte, Präsident Alpha Condé sei ab- und die Verfassung außer Kraft gesetzt, ging es am Montag mit dem regierenden Kabinett weiter. Dessen Angehörige wurden aufgefordert, ihre Reisepässe und Dienstfahrzeuge abzugeben, das Land zu verlassen, wurde ihnen untersagt.


08.09.2021 11:43:42 [Telepolis]
Giftgas in Syrien: BBC gesteht Fake News ein
Im Rahmen einer seit Jahren laufenden Kontroverse um einen angeblichen Giftgasangriff in der syrischen Stadt Douma hat die britische BBC nun eingestanden, diffamierende Aussagen über Kritiker der Organisation für das Verbot chemischer Waffen (OPCW) erfunden und journalistische Standards verletzt zu haben. Das berichtet die britische Tageszeitung Daily Mail.

Die betroffenen Personen hatten beanstandet, dass die OPCW den Angriff im April 2018 umgehend der Führung von Baschar al-Assad anlastete und dieser These widersprechende Erkenntnisse zensierte. Die Organisation lieferte mit ihrem Bericht eine Rechtfertigung für Luftangriffe der USA, Großbritanniens und Frankreichs.

08.09.2021 17:14:47 [TAZ]
Unbefristeter Arbeitskampf kommt
Am Donnerstag treten die Beschäftigten der kommunalen Krankenhäuser Charité und Vivantes in den unbefristeten Arbeitskampf ein. Das teilte die Berliner Krankenhausbewegung, in der sich die Beschäftigten organisiert haben, am Mittwoch mit. Laut zwei der taz vorliegenden Streikaufrufen ruft die Gewerkschaft Verdi alle Pflegenden – inklusive Auszubildenden und Praktikanten – sowie die Beschäftigten der Tochterunternehmen dazu auf, ab Donnerstag ihre Arbeit niederzulegen.

Die Gewerkschaft werde aber die Notversorgung von Patienten stets sicherstellen. Meike Jäger, die zuständige Verdi-Landesfachbereichsleiterin, sagte der taz, man wolle ein „klares Signal setzen, dass die Kollegen es ernst meinen“.

08.09.2021 17:40:18 [German Foreign Policy]
Westsahara-Konflikt: Nicht mehr alternativlos
Politische Spannungen zwischen Deutschland und Marokko gefährden ein wichtiges Vorhaben der deutschen Energiewende. Dabei handelt es sich um den Bau einer Anlage zur Herstellung "grünen" Wasserstoffs in Marokko, mit dem die Bundesrepublik versorgt werden soll. Gefährdet ist das großenteils aus Deutschland finanzierte Projekt, weil Rabat die diplomatischen Beziehungen zu Berlin eingefroren hat. Dies gilt als rüder Versuch, die Bundesregierung zur Anerkennung von Marokkos Ansprüchen auf die Westsahara zu veranlassen. Bei der Anerkennung dieser Ansprüche hat Rabat zuletzt Fortschritte gemacht - nicht zuletzt dank seiner aktiven Afrikapolitik.
09.09.2021 07:25:16 [Junge Welt]
Pflege am Limit: Zusammen kämpfen
Ab diesem Donnerstag ruft die Gewerkschaft Verdi an den Berliner Kliniken von Charité und Vivantes sowie den Vivantes-Tochtergesellschaften zum unbefristeten Streik auf. Das kommt nicht überraschend. Im Mai hatten die Beschäftigten den öffentlichen Krankenhausbetreibern und dem Berliner Senat ein 100-Tage-Ultimatum gestellt: Sollte es bei den Tarifauseinandersetzungen um Entlastung und angemessene Bezahlung für alle keine substantiellen Fortschritte geben, werde man die Arbeit niederlegen. Danach folgten noch mehrere Warnstreiks und eine Urabstimmung, bei der sich die überwältigende Mehrheit der Gewerkschaftsmitglieder für den Arbeitskampf aussprach.
09.09.2021 11:22:06 [T-Online]
Spahn: Lohnabzug für Ungeimpfte in Quarantäne gerechtfertigt
Bundesgesundheitsminister Jens Spahn (CDU) setzt darauf, an Orten des öffentlichen Lebens mehr Menschen für die Corona-Impfung zu gewinnen. Deshalb startet in der kommenden Woche eine Aktionswoche mit mehreren Verbänden, die noch mehr Menschen von einer Impfung überzeugen soll. Es fehle noch immer an der "einfachen Gelegenheit" zum Impfen, sagte der Minister am Mittwoch in Berlin. Er nannte Spiel- und Sportplätze, Fußgängerzonen und Einkaufsgeschäfte. Er sei Ländern, Kommunen und Helfern dankbar für viele "kreative Ideen".


09.09.2021 11:32:19 [Junge Welt]
Hambacher Forst: Laschets Vorwand bestätigt
Die Räumung der Baumhäuser des Protestcamps im Hambacher Forst war rechtswidrig. Das hat das Verwaltungsgericht Köln in einer am Mittwoch verkündeten Entscheidung festgestellt. Sie ist das Ergebnis der Klage eines ehemaligen Baumhausbewohners gegen die Stadt Kerpen, die im September 2018 auf Weisung der Landesregierung Nordrhein-Westfalens von Ministerpräsident Armin Laschet (CDU) die Räumung des Protestcamps durch Polizei und Beschäftigte des Kohletagebaubetreibers RWE durchgeführt hatte.

Der ehemalige Bewohner des Camps hatte gegen die erfolgte Zerstörung seines Wohnraums geklagt.

09.09.2021 15:27:28 [Telepolis]
Hambacher Forst: Armin Laschet agierte illegal
Die Räumung des Hambacher Forst im Rheinland im September 2018 war eines der auslösenden Momente der neuen Klimaschutzbewegung in Deutschland. Rund zwei Wochen lang hielt seinerzeit einer der größten Polizeieinsätze in der Geschichte Nordrhein-Westfalens die Republik in Atem. Der Wald war der Ausweitung des gleichnamigen Braunkohletagebaus im Wege und sollte gefällt werden.

Nun hat am gestrigen Mittwoch das Kölner Verwaltungsgericht festgestellt, was schon vor drei Jahren von vielen angenommen wurde: Die gewalttätige Räumung der Baumhäuser war rechtswidrig. Die Begründung für den Einsatz sei vorgeschoben gewesen.

09.09.2021 16:50:52 [Tichys Einblick]
Durchsuchung im Finanzministerium: Die Kompetenz des Olaf Scholz
Das Ministerium des voraussichtlich nächsten Bundeskanzlers wurde heute von der Staatsanwaltschaft durchsucht. Geldwäsche-Verdachtsmeldungen sollen von einer Einheit des Ministeriums nicht an die Justiz weitergeleitet worden sein. In der breiten Öffentlichkeit, also beim Wähler scheint Scholz‘ Ignoranz den Versäumnissen seiner Beamten gegenüber ebenso wenig wirksam zu werden wie seine höchst zwielichtige Rolle in der Hamburger CumEx-Affäre. Auch hier geht es darum, dass Scholz sich taub und blind stellt gegenüber dem Verhalten der Behörde, der er vorstand. Er beruft sich zu seiner eigenen Rechtfertigung auf Erinnerungslücken.
10.09.2021 06:59:52 [Junge Welt]
Palästina: Aufstand nach Ausbruch
Nach dem spektakulären Ausbruch von sechs palästinensischen Gefangenen am Montag aus dem israelischen Hochsicherheitsgefängnis in Gilboa spitzt sich die Lage in den besetzten Gebieten zu. Am Mittwoch abend fanden an vielen Orten auf der Westbank und in Ostjerusalem Demonstrationen statt, berichtete die palästinensische Nachrichtenagentur WAFA. Dabei gab es Verletzte, es kam zu Sachschaden.

In Huwara bei Nablus reagierten israelische Soldaten laut WAFA mit Tränengas und Blendgranaten auf eine Kundgebung in der Nähe eines militärischen Kontrollpunkts.

10.09.2021 09:41:42 [Netzpolitik]
Laschets umstrittenes Versammlungsgesetz soll erst nach der Bundestagswahl kommen
Das neue, heftig diskutierte Versammlungsgesetz in Nordrhein-Westfalen kommt nicht mehr vor der Bundestagswahl. Das bestätigen Vertreter aus Regierung und Opposition gleichermaßen. Das Gesetz wird erst am 23. September wieder im Innenausschuss behandelt, um die Sachverständigenanhörung aus dem Frühsommer auszuwerten. Die Grünen vermuten, dass die schwarz-gelbe Regierungskoalition den Änderungsantrag dann nicht vor dem 28. Oktober einbringt. Das würde bedeuten, dass das Gesetz in zweiter Lesung erst am 3. November ins Parlament kommen könnte.

Ursprünglich wollte NRW-Landesinnenminister Herbert Reul das Versammlungsgesetz schon vor den Sommerferien durchs Parlament kriegen.

10.09.2021 13:09:06 [Zeit Online]
Wahlumfragen: Forsa zieht gegen Bundeswahlleiter vor Gericht
Das Umfrageinstitut Forsa will vom Verwaltungsgericht Wiesbaden klären lassen, ob die bisherige Praxis bei Umfragen rechtskonform ist. Wie ein Sprecher von Bundeswahlleiter Georg Thiel auf Nachfrage sagte, hat Forsa dort einen Antrag auf "gerichtliche Entscheidung in einer Verwaltungsstreitsache" gestellt. Hintergrund ist die gängige Praxis, dass Umfrageinstitute bei ihren Sonntagsfragen nicht nur die Wahlabsicht abfragen, sondern auch, ob die Befragten schon Briefwahl gemacht haben – die Wahlentscheidung also bereits vollzogen ist.
10.09.2021 15:15:23 [Infosperber]
Deutscher Streit um ein Kriegsschiff
Seit Anfang August ist die deutsche Fregatte «Bayern» auf dem Weg in den Indo-Pazifik. Offiziell geht es um die Freiheit der Meere und die Sicherheit der Seewege. Deutschland will zusammen mit seinen Partnerstaaten gegenüber China klarmachen, dass Gebietsansprüche im Südchinesischen Meer nicht nach dem Prinzip des Stärkeren durchgesetzt werden können. Vor dem Auslaufen des Kriegsschiffs in Wilhelmshaven war von offizieller Seite viel die Rede von gemeinsamen Werten und von einer «regelbasierten internationalen Ordnung». Doch in Sachen Völkerrecht ist die Reise der Fregatte selbst nicht stubenrein.
10.09.2021 17:13:21 [Tichys Einblick]
Joe Biden kündigt Impfpflicht für 100 Millionen Amerikaner an
53 Prozent der US-Amerikaner sind geimpft. Zu wenig, findet Präsident Biden. „Nun ist unsere Geduld erschöpft“, erklärt er in einer Ansprache aus dem Weißen Haus – und verkündet eine umfassende Impfpflicht. Der Erlass des Weißen Hauses betrifft nicht nur alle Mitarbeiter der Bundesbehörden und Angestellte des öffentlichen Gesundheitswesens, sondern auch Beschäftigte größerer Unternehmen. Ab 100 Angestellten fallen Firmen unter die neue Impfpflicht. Rund 100 Millionen Amerikaner, zwei Drittel der arbeitenden Bevölkerung, müssen sich nun impfen lassen.
10.09.2021 18:43:23 [Business Insider]
Manipulative Sonntagsfragen zur Bundestagswahl?
Es ist ein bislang wohl einmaliger Vorgang: Eines der führenden deutschen Meinungsforschungsinstitute, Forsa, zieht vor dem Verwaltungsgericht Wiesbaden gegen den Bundeswahlleiter vor Gericht. Nach Informationen von Business Insider geht es bei dem Streit um den Vorwurf der indirekten Wahlmanipulation nur zwei Wochen vor der Bundestagswahl. Ein Sprecher von Bundeswahlleiter Georg Thiel bestätigt die Klage auf Anfrage. Hintergrund ist die sogenannte Sonntagsfrage, die Umfrageinstitute wie Forsa alle paar Wochen ermittelt.
11.09.2021 07:21:05 [Junge Welt]
#mietendemo21: Löhne rauf, Mieten runter!
Löhne stagnieren seit Jahren, die Mieten für Wohnraum und Gewerbe sind dagegen explodiert. Viele Menschen können sich ein Leben in der Stadt nicht mehr leisten. Während Wohnungskonzerne die Preise weiter in die Höhe treiben und hohe Gewinne einfahren, gehören Zwangsräumungen und Verdrängung zur täglichen Realität. Viele wollen sich das Mietmonopoly jedoch nicht länger bieten lassen: Ein breites Bündnis ruft an diesem Sonnabend, dem Tag der Wohnungslosen, zur »Mietendemo 21« gegen hohe Mieten und Verdrängung nach Berlin auf.
11.09.2021 07:22:35 [Telepolis]
Ausgebremste Autoshow
Für die Protestbewegung sind es trotz Repression erfolgreiche Tage: Ein möglichst reibungsloser Ablauf der Automesse IAA Mobility war das Ziel des Polizeieinsatzes, den Bayerns Innenminister Joachim Herrmann (CSU) als größten seit 20 Jahren in der Landeshauptstadt angekündigt hatte. Dass dies gründlich misslingen würde, hatte sich bereits am Dienstag abgezeichnet, als sich zum Auftakt der Messe mehrere Personen von Autobahnbrücken abgeseilt und vorübergehend den Verkehr rund um München lahmgelegt hatten.

Daraufhin war die Polizei mit rund 4.500 Beamten eifrig bemüht, weitere Stör- und Protestaktionen der Umwelt- und Klimabewegung im Keim zu ersticken.

11.09.2021 12:00:32 [WSWS]
Große Beteiligung am Pflege-Streik in Berlin
Seit Donnerstag haben sich bereits über 2.000 Beschäftigte an dem unbefristeten Streik an den Berliner Kliniken von Charité und Vivantes beteiligt. Bis nächste Woche müssen 30 Normalstationen sowie drei intensivmedizinische Bereiche und insgesamt 1.000 Betten schließen, erklärte ein Vertreter des Vivantes-Konzern. Täglich versammeln sich Beschäftigte an den Streikposten, auf Demonstrationen und auf Kundgebungen. Allein am Donnerstag beteiligten sich über 1.000 Arbeiter an einem Demonstrationszug zur Berliner Gesundheitsverwaltung. Am Freitag kamen Hunderte am Virchow-Klinikum im Wedding zusammen.
11.09.2021 12:11:23 [Junge Welt]
Fertigstellung von Nord Stream 2
Die finale Lücke ist geschlossen. Am Montag habe man das letzte Rohr der Erdgaspipeline Nord Stream 2 verlegt, am Freitag dann die letzten Abschnitte der Leitung miteinander verbunden, teilte Gasprom wenig später mit. Nun stehe noch ein abschließender Schliff bevor, und dann könne im Oktober das erste Erdgas in die Röhre gepumpt und durch die Ostsee direkt nach Deutschland geliefert werden. Bis zu 5,6 Milliarden Kubikmeter Erdgas könne man in diesem Jahr schaffen, heißt es bei Gasprom. Man warte nur noch auf eine Zertifizierung durch die deutschen Behörden. Liegt diese vor, dann steht dem Vollbetrieb nichts mehr im Weg.
11.09.2021 16:26:14 [Multipolar]
Die Zerstörung des World Trade Centers
Vorbemerkung: Das folgende Gespräch mit dem Physiker Ansgar Schneider zu den technischen Aspekten des Zusammenbruchs der drei Türme des World Trade Centers in New York am 11. September 2001 enthält argumentativen Sprengstoff. Die präzisen baustatischen (und logischen) Details sind auch 20 Jahre nach dem Ereignis brisant. Zugleich erscheint das Beharren auf ehrliche und transparente Wissenschaft, die sich einer ergebnisoffenen Diskussion stellt, heute aktueller und dringlicher denn je.
12.09.2021 11:51:43 [Zeit Online]
Barcelona: Mehr als 100.000 Katalanen demonstrieren für Unabhängigkeit
Wenige Tage vor neuen offiziellen Gesprächen zur Zukunft der spanischen Region Katalonien haben mehr als 100.000 Unabhängigkeitsbefürworter in Barcelona demonstriert. Die Demonstration am Samstag stand unter dem Motto: "Wir werden für die Unabhängigkeit kämpfen und gewinnen." Der Protest fand traditionell am katalanischen Feiertag Diada statt.

Die Polizei schätzte die Teilnehmerzahl auf 108.000, die Organisatoren gaben die Zahl mit 400.000 an. In jedem Fall war die Teilnehmerzahl weitaus niedriger als auf dem Höhepunkt der Unabhängigkeitsbewegung vor sieben Jahren.

12.09.2021 12:09:48 [NachDenkSeiten]
Bildungsspritze: Wer in Deutschland studieren will, muss den Ärmel hochkrempeln
Die ärmsten Schweine in der Corona-Krise sind die Studierenden. Eineinhalb Jahre im Homeoffice verschanzt – ohne Kontakte, ohne Party, ohne Geld, dafür mit Depressionen – ist ihr Schicksal in der Öffentlichkeit bis heute ein großer blinder Fleck. Aber bald wird alles „besser“: Im Wintersemester wollen die Hochschulen großflächig zum Präsenzbetrieb zurückkehren. Allerdings ist des Geimpften Freud des „Impfmuffels“ Leid. Wer den Pieks mit experimentellen Vakzinen verweigert und Tausende Euro extra für Schnelltests scheut, muss leider draußen bleiben. Und auf digitale Distanzlehre darf er auch nicht mehr hoffen. Das ist ganz offizielle Linie und fast alle zeigen sich linientreu – sogar Studentenvertreter.
12.09.2021 14:03:09 [Tichys Einblick]
Offensichtliche Skandale belasten den SPD-Kanzlerkandidaten nicht
Razzia im Finanzministerium. In dem Haus, das der Kanzlerkandidat der SPD leitet. Keine drei Wochen vor der Wahl. Eigentlich müsste diese Nachricht durch die Decke gehen. Doch das tut sie nicht. Zwar greifen alle Medien die Razzia auf, doch nicht unbedingt als Topmeldung. Die Bild etwa hält in ihrer Bundesausgabe am Freitag den CSU-Generalsekretär, der gegen den CDU-Kandidaten möppert, für die härtere Geschichte und setzt mit Scholz am unteren Blattrand auf.

In den sozialen Netzwerken ist diese Gewichtung ein Thema: CDU nahe Accounts monieren, die Medien würden das Thema tot schweigen, andere konservative Nutzer verstärken die Kritik. Doch sie greift zu kurz.

12.09.2021 14:15:20 [Der Freitag]
Wird der Sahel zum neuen Afghanistan?
Die Truppen der EU-Staaten kämpfen mit Problemen wie am Hindukusch – die Lage ist allerdings noch komplizierter. Wenn die Armee einen verhaftet, rächen sich die Terroristen an uns Zivilisten, weil sie meinen, dass wir sie an die Armee verraten haben“, klagt ein Bauer aus dem Nordwesten Malis. Dort wurden in der vergangenen Woche bei Anschlägen in vier Dörfern 51 Menschen ermordet. Das erklärt, weshalb viele Bewohner des Sahel nicht mehr auf Schutz durch offizielle Streitkräfte rechnen und diese auch nicht mehr im Kampf gegen die zahlreichen Dschihadistengruppen unterstützen, die sich teils al-Qaida, teils dem sogenannten Islamischen Staat (IS) zurechnen.
12.09.2021 17:18:02 [Heise]
9/11: FBI veröffentlicht erstes bisher geheimes Dokument zu Ermittlungen
Die US-amerikanische Bundespolizei FBI kommt einer Anordnung des US-Präsidenten Joe Biden nach und hat ein erstes Dokument zu den Vorgängen rund um die Attentate vom 11. September 2001 veröffentlicht. In dem teilweise ausgegrauten 16-seitigen Dokument geht es um Kontakte zwischen den Entführern der vier Passagiermaschinen und saudi-arabischen Beamten. Daraus geht aber kein Beweis hervor, dass die saudi-arabische Regierung an den Anschlägen beteiligt war.

Biden hatte am 3. September eine Executive Order erlassen, laut der vor allem die Überlebenden und Angehörigen der Opfer der Anschläge ein vollständigeres Bild über die Vorgänge vor 20 Jahren bekommen sollen.

13.09.2021 07:22:53 [Telepolis]
"Sind offen, Erdgas über ukrainisches Staatsgebiet zu befördern"
Gastbeitrag des außerordentlichen und bevollmächtigten Botschafters der Russischen Föderation in Deutschland. Die Gasleitung Nord Stream 2, die vor dem Hintergrund der Energiewende zur Diversifizierung von Lieferungen und Verbesserung der Energiesicherheit Deutschlands und der EU beitragen soll, ist fertiggestellt.

Nun stehen technische Prüfungen und Zertifizierung an. Gazprom rechnet damit, bereits im laufenden Jahr erste Lieferungen durchzuführen. Viel hängt an dieser Stelle von entsprechenden deutschen Stellen ab. Nord Stream 2 wird eine wichtige Rolle bei der Umsetzung von European Green Deal und der deutschen Klimastrategie spielen.

13.09.2021 09:31:31 [Junge Welt]
Autolobby ausbremsen
Es war ein Spektakel, aber weniger im Sinne der Autolobbyisten: Am Wochenende ging die Messe »IAA Mobility« in München zu Ende, gegen die Klimaaktivisten und Umweltschützer seit Tagen öffentlichkeitswirksam protestierten. Die Verantwortlichen für die Internationale Automobilausstellung (IAA) versuchten, die Veranstaltung als großen Erfolg im Sinne »nachhaltiger« Mobilität zu inszenieren und freuten sich über 400.000 Besucher, wie es am Sonntag hieß. Auf wessen Seite Kapital und Politik stehen, zeigte sich aber beim Umgang mit dem Protest gegen die »Greenwashing«-Versuche der Autoindustrie.
13.09.2021 12:08:56 [Junge Welt]
Keine Überraschung: 20 Jahre 9/11: USA geben Dokumente frei
Nein, in Washington wird immer noch nicht aufgeklärt. Da hat US-Präsident Joseph Biden, unter erheblichen Druck von Angehörigen der Opfer geraten, angekündigt, bislang geheime Dokumente endlich zu publizieren. Diese sollen Auskunft über die Unterstützung Saudi-Arabiens für die Attentäter des 11. September 2001 geben – klare Hinweise darauf liegen schließlich seit 20 Jahren vor. Und was zeigt sich? Das erste Papier, das am Wochenende veröffentlicht wurde, ist so ausgewählt, dass es keine wirklichen Erkenntnisfortschritte bringt; zudem ist es an vielen Stellen geschwärzt – natürlich zuweilen genau dort, wo es spannend werden könnte.
13.09.2021 12:10:44 [Tichys Einblick]
Das Triell: Laschet verpasste seine Chance und Scholz verträgt keinen Angriff
Baerbock jubelte: „Na endlich haben wir Sie so weit, dass Sie Ihre eigenen Aussagen aus dem Bundestag korrigieren!“ Scholz lächelte leise in sich hinein. Jeder der drei Kontrahenten des Triell genannten gestrigen ersten Showdowns zur Bundestagswahl (Teil 2 folgt am kommenden Sonntag) hoffte darauf, mit einer guten Figur Punkte gutzumachen. Wobei gleichzeitig jeder wusste, dass an der Ausgangslage auch dieses Duell nicht mehr allzu viel zu ändern vermag. Dass die Grüne Annalena Baerbock auch nur noch eine Minimal-Chance auf den ersehnten Stuhl im Kanzleramt haben könnte, kann sie selbst nicht ernsthaft gedacht haben.
13.09.2021 15:48:02 [Reitschuster]
Zweites Triell – Baerbock will Bargeld abschaffen und Kinder impfen
Wahlarena zweiter Durchgang, wieder mit den drei hinreichend bekannten Kanzlerkandidaten und wieder ohne weitere Parteien, wieder ohne die AfD in der Rolle des Oppositionsführers.

Dieses Mal nicht bei den Privaten, sondern wie früher beim öffentlich-rechtlichen Fernsehen, jenen Sendeanstalten, die einen großen Teil dazu beigetragen haben, eine Kandidatin der kleinsten Fraktion im Deutschen Bundestag überhaupt erst für die Rolle der Kanzlerkandidatin denkbar zu machen.

Irgendwann wird vielleicht einmal ein fleißiger investigativer Journalist kommen und ausrechnen, welchen Wert diese Sendezeit der letzten vier Jahre in Euro hat.

13.09.2021 17:08:51 [Blick nach rechts]
Anonymous kapert Kanäle und Seiten von Attila Hildmann
Große Teile der Internet-Seiten und Telegram-Kanäle des Antisemiten, Rechtsextremisten und Verschwörungsideologen Attila Hildmann sind aktuell offenbar nicht mehr in dessen Besitz. Das „Anonymous Kollektiv“ will diese übernommen haben. Dies teilte besagtes „Kollektiv“ am frühen Morgen auf seiner Webseite „Anon Leaks“ mit und beschreibt ausführlich, wie es dazu kam. Besagtes „Kollektiv“ hat in der Vergangenheit mehrfach Daten über Personen und Netzwerke aus dem rechten und verschwörungsideologischen Spektrum publiziert, die unter anderem durch Hacking sowie weitreichende Recherchen gewonnen wurden.
14.09.2021 06:51:08 [Junge Welt]
Pokern um das Gas
Auch die technische Fertigstellung der deutsch-russischen Pipeline Nord Stream 2 lässt die Gegner des Projekts nicht ruhen. Maksim Biljatskyj, Pressesprecher des ukrainischen Netzbetreibers Naftogas, sagte vergangene Woche gegenüber dem russischen Dienst der "Deutschen Welle", sein Land werde bis zum Schluss gegen die Inbetriebnahme der Leitung kämpfen. Die Ukraine halte sie für technisch unsicher, erklärte Biljatskyj; sie sei nach einem mangelhaften Sicherheitssystem verlegt worden. Was die Ukraine, die nicht an die Ostsee grenzt, mit dem Zustand dieses Meeres zu schaffen hat, präzisierte er nicht.
14.09.2021 09:20:05 [Telepolis]
Finanzieren deutsche Botschaftsangestellte Nawalny?
Eine von anonymen russischen Hackern veröffentlichte Liste verursacht eine neue Verstimmung zwischen dem russischen und deutschen Außenministerium. Sie enthält Namen von vorgeblichen deutschen Botschaftsbeschäftigten, die angeblich Nawalnys Kampagne "Smart Voting" finanzieren sollen. Wenn es um das Thema ausländische Einmischung in die am kommenden Wochenende stattfindende russische Parlamentswahl geht, sind die Nerven der Offiziellen angespannt. Die Umfragen für die Regierungspartei sind nicht gut und mit der "Smart Voting"-Kampagne der Organisationen des inhaftierten Oppositionellen Nawalny, die mittlerweile offiziell als "extremistisch" erklärt wurden, gibt es ein Feindbild.
14.09.2021 11:36:04 [German Foreign Policy]
Besatzungsökonomie ohne Besatzer
Nach dem Abzug des Westens aus Afghanistan suchen die Vereinten Nationen die Bevölkerung des Landes mit dem Nötigsten zu versorgen. Eine UN-Geberkonferenz in Genf konnte am gestrigen Montag Hilfszusagen von mehr als einer Milliarde US-Dollar einwerben; die Bundesrepublik stellte 100 Millionen Euro in Aussicht. Hintergrund ist, dass es dem Westen während der 20-jährigen Besatzungszeit nicht gelungen ist, die afghanische Wirtschaft aufzubauen: Sie blieb von umfangreichen Zahlungen aus dem Ausland abhängig, die bestimmte Sektoren aufblähten - etwa Dienstleistungen für westliches und Regierungspersonal -, aber nicht für den Aufbau einer auch nur annähernd eigenständigen Produktion sorgten.
14.09.2021 12:58:50 [Blick nach rechts]
Niedersachsen: AfD büßt landesweit ein
Bei den Kommunalwahlen in Niedersachsen hat die AfD landesweit ihre 2016 gewonnene Stellung als vierstärkste Partei verloren und ist hinter die FDP gerutscht. Mit Verlusten von 3,3 Prozent landet sie nur noch bei 4,6 Prozent. In einem zutiefst zerstrittenen Landesverband, der bereits im Landtag vor knapp einem Jahr seinen Fraktionsstatus verlor, nicht unbedingt verwunderlich. In der Stadt Delmenhorst ist der AfD trotz Einbußen eine Hochburg geblieben. Dort war man vor fünf Jahren noch mit sieben errungenen Mandaten drittstärkste Fraktion im Stadtrat, besaß zuletzt nach internen Querelen aber nur noch drei Sitze. Jetzt ist die Partei mit 8,3 Prozent nur noch fünfstärkste Partei.
14.09.2021 14:46:26 [Heise]
Hamburgs Hafen wird Blaupause für Drohnen-Lufträume
Hamburgs Hafen soll die bundesweit erste Blaupause für reguläre Drohnen-Lufträume in Deutschland werden. Auf dem Weg dahin starten jetzt erste Testflüge im Gebiet des größten deutschen Seehafens. "In mehreren Flugszenarien wird unter anderem das sichere und koordinierte Zusammenspiel von bemanntem und unbemanntem Flugverkehr in dem in Hamburg eingerichteten U-Space-Luftraum simuliert", berichtet die Droniq GmbH, eine Beteiligung der staatliche Deutschen Flugsicherung (DFS) und der Deutschen Telekom. Das Konzept eines "U-Space" ist ein räumlich abgegrenzter Luftraum, in dem der Idee nach spezielle Regeln und Verfahren den Drohnenverkehr koordinieren.
15.09.2021 07:26:29 [Telepolis]
US-Centcom: Schäbige, mörderische Geheimdienstarbeit
Der Drohnen-Angriff, den das US-Militär am 29. August 2021 in Kabul durchführte, um sich am IS in Afghanistan zu rächen, war ein Desaster. US-Präsiden Biden hatte Rache verkündet, die Hellfire-Rakete, abgeschossen von einer Predator-Drohne, tötete 10 Unschuldige, darunter sieben Kinder.

Das mag Abgebrühte, die sich daran erinnern, dass US-Drohnenangriffe bei Hochzeitsgesellschaften irrtümlich Zivilisten töteten, nicht weiter schockieren, schaut man allerdings auf die Reaktion des US-Militärs und die Hintergründe des "Vergeltungs-, bzw. Präventivschlags", so tun sich Abgründe auf.

15.09.2021 09:42:34 [Heise]
NSO-Skandal: Apple-Updates beheben endlich Pegasus-Lücke
Apple hat in der Nacht zum Dienstag überraschend neue Betriebssystemversionen vorgelegt. Zentrale Neuerung ist die Tatsache, dass es dem Konzern offenbar endlich gelungen ist, eine von der Sicherheitsfirma NSO Group ausgenutzte "Zero Click"-Sicherheitslücke zu schließen, mit der die Spyware Pegasus über iMessage verbreitet wurde. Apple hatte sich über Wochen nicht dazu geäußert, ob und wie der Konzern beabsichtigt, hier einen Fix zu liefern. Zuletzt war bekannt geworden, dass auch das Bundeskriminalamt Pegasus erworben haben soll.
15.09.2021 09:46:41 [RT DE]
Assad trifft Putin
Der syrische Präsident Baschar al-Assad stattete am Montag Moskau einen Besuch ab und traf sich dabei zu Gesprächen mit seinem russischen Amtskollegen Wladimir Putin. Putin bekräftigte die russische Unterstützung für die Rückeroberung der weiterhin von Terroristen und ausländischen Streitkräften (wie USA) besetzten Gebiete durch die legitime Regierung in Damaskus. Vor dem Hintergrund dieses Treffen hatte die syrische Armee mit Vermittlung Russlands kürzlich den Stadtteil Darʿā al-Balad von den Islamisten zurückerobert.
15.09.2021 09:56:21 [Junge Welt]
Militarisierung: Staatsmacht rüstet auf
Feindbild Flüchtlinge, Abschottung der EU, militärisches Equipment: In Berlin tagt der »Europäische Polizeikongress«. In der futuristisch wirkenden Berliner Kongresshalle am Alexanderplatz, wo sich bis Mitte der 70er Jahre die Volkskammer der DDR versammelte, tagen seit Dienstag wieder Landesinnenminister und andere Politiker, Leiter von Polizeibehörden, Grenzschutz und Geheimdiensten sowie Waffenlobbyisten – zum Beispiel des Rüstungskonzerns Heckler und Koch – aus mehr als 20 Staaten. Beim Blick aus dem Fenster können sich die Teilnehmer des »24. Europäischen Polizeikongresses« von den großflächigen Mosaiken am benachbarten »Haus des Lehrers« über den Nutzen von Wissenschaft und Technik zum Wohle des Menschen im Sozialismus unterrichten lassen.
15.09.2021 15:41:39 [Tichys Einblick]
Rot-Rot-Grün in Berlin beschließt harte 2G-Regel
Sachsen hat seine Schulkinder durchgetestet und eine Positivenquote von ganzen 0,02 Prozent gefunden. Dennoch werden die Regeln jetzt bundesweit angezogen. Dem Berliner Senat unterläuft dabei ein mindestens peinlicher Fehler. Berlin steht immer an der Spitze des Fortschritts – meistens an der Spitze des Fortschreitens in Absurditäten. Und so ist der Hauptstadtstaat das erste Bundesland, welches eine harte 2G-Regelung einführt. Während andere Länder wie Hamburg, Baden-Württemberg oder Rheinland-Pfalz 2G-Regelungen eingeführt haben oder planen, enthalten diese eine Reihe von Ausnahmen.
15.09.2021 17:14:00 [Telepolis]
Iran: Bald Vollmitglied beim "Gegenpol zur Nato"
Morgen trifft sich die Shanghaier Organisation für Zusammenarbeit (SOZ, englisch: SOC) zu einem Gipfel in Tadschikistan. Die Situation in Afghanistan ein großes Thema der Zusammenkunft sein, größere Beachtung bekommt aber auch die erwartete Aufnahme Irans in die Vereinigung, der geopolitisch ein wachsendes Gewicht zugemessen wird. Derzeit hat die SOZ acht Mitglieder: China, Russland, Indien, Pakistan, Kirgistan, Tadschikistan, Usbekistan und Kasachstan. Iran hat seit 2005 einen Bobachterstatus, wie auch die Mongolei, Belarus (Weißrussland) und Afghanistan.
 Sport (49)
01.09.2021 08:42:16 [Neues Deutschland]
BallHaus Ost: Wildern im Berliner Fußballdschungel
Von Viktoria über den BAK bis nach Hohenschönhhausen zum BFC Dynamo. Zu leben, bis man stirbt, ist schon genug harte Arbeit, pflegte meine Oma zu philosophieren, wenn mal irgendwo der Schuh drückte. Jetzt aber bläst mir und euch endlich der Fußballwind der ewigen Freude wieder ins Gesicht und lässt uns von guten Taten träumen. Weil ich keine Büchse Mett als Herz mit mir herumtrage, sondern die einst eingepflanzte Fackel des Fußballsports, treibt es mich jedes verdammte Wochenende raus. Wie ein wildes Tier, das aus einem Wald herausspäht, erkenne ich aus der Ferne fliegende Bälle und schnurre sogleich wie eine Katze.
01.09.2021 08:43:53 [Frankfurter Allgemeine Zeitung]
Das vollmundige Versprechen des Cristiano Ronaldo
Die Rückkehr von Cristian Ronaldo zu Manchester United ist perfekt. Wie der englische Fußball-Rekordmeister am Dienstag verkündete, unterschrieb Ronaldo einen Zweijahresvertrag mit Option auf ein weiteres. Der 36-Jährige veröffentlichte daraufhin eine emotionale Botschaft auf Instagram, in der er sich auch an seinen früheren Trainer und Förderer Sir Alex Ferguson wandte. „Ich bin genau hier! Ich bin wieder da, wo ich hingehöre!“, schrieb Ronaldo. „Sir Alex, das ist für dich ...“
01.09.2021 08:46:26 [Süddeutsche Zeitung]
Ein Fußballer ist kein Lokführer
Zum Ende des Transferfensters neigen manche Profifußballer zu Arbeitsverweigerung, um einen Vereinswechsel zu erzwingen. Klubs dürfen solchen Streiks nicht nachgeben - schon aus Eigeninteresse. Der erste dokumentierte Streik der Weltgeschichte soll im ägyptischen Dorf Deir el-Medineh stattgefunden haben, im Jahr 1159 vor Christus. Die Arbeiter dort errichteten die Totengräber im Tal der Könige und wurden hauptsächlich mit Getreide entlohnt. Als die Lieferungen ausblieben, hörten sie auf zu arbeiten und zogen mit ihren Forderungen zum Pharao. Die Vorräte seien erschöpft, man leide am Mangel. "Eine Last von Steinschutt zu schleppen, ist aber nicht leicht", notierte ein Arbeiter auf einer Tonscherbe.
01.09.2021 08:48:12 [TAZ]
Afghanen bei den Paralympics in Tokio: Für den Sport evakuiert
Afghanistan fehlt bei den Paralympics – als Team. Aber ein Sportler und eine Sportlerin sind doch da. Den Organisatoren passen sie ins Konzept. „Wie Sie sich vorstellen können, war das Zusammentreffen extrem emotional. Es flossen viele Tränen, von jedem im Raum“, sagt Craig Spence und beginnt selbst zu schluchzen. „Es war wirklich, wirklich ein bemerkenswertes Treffen. Wenn man Bilder gesehen hat, wie die Athleten am Flughafen evakuiert wurden, und man sie dann persönlich trifft … wenn sie dann ins Paralympische Dorf ziehen … das ist so groß. Ich glaube, das werde ich nie vergessen. Es unterstreicht die Fähigkeit des Sports, die Menschheit zusammenzubringen.“
01.09.2021 08:50:05 [Neues Deutschland]
Solidarisch zum Erfolg
Mehr Zeit, Geld und Wissen: Wie die Niederländer ihre Parasportler fördern. Nach dem Spiel rollt Carina de Rooij durch die Mixed Zone, wo Journalisten auf Athleten treffen, und klatscht souverän mit ihren Kolleginnen ab. Das unaufgeregte Verhalten erklärt: Hier ist nichts Besonderes passiert. Dabei haben die niederländischen Rollstuhlbasketballerinnen gerade Algerien mit 109:18 besiegt. Haushoch und doch erwartbar. »Wir hätten schon gerne Gold«, sagt de Rooij später, als könnte sie es sich aussuchen. 2018 wurden die Niederländerinnen Weltmeisterinnen, 2016 in Rio holten sie bei den Paralympics Bronze.
01.09.2021 08:52:00 [Süddeutsche Zeitung]
Ironman-WM auf Hawaii: Im Keller statt auf Kona
Auch in diesem Jahr gibt es keine Ironman-WM auf Hawaii. Die deutschen Weltklasse-Triathleten Jan Frodeno und Laura Philipp kritisieren die Entscheidung - und sinnieren über Alternativen. Die Stimme füllt sich mit Enttäuschung, als der Triathlet Jan Frodeno auf die verschobene Ironman-WM auf Hawaii zu sprechen kommt, während er gerade vom Flughafen in Barcelona zu seiner Familie nach Girona fährt. "Die Entscheidung, den Ironman in den Februar zu verschieben, halte ich persönlich für albern", sagt er. Nach 2020 fällt auch in diesem Jahr die mythisch umwehte Langstrecke auf Kona aus, dafür soll es nächstes Jahr gleich zwei geben, im Februar und Oktober.
01.09.2021 08:53:16 [Junge Welt]
Ankunft der Abrissbirne
Der traditionsreiche Dresdner Sportclub 1898 nimmt Abschied vom legendären Heinz-Steyer-Stadion. Wer den Dresdner Sportclub 1898 für eine Fußnote in der Geschichte des Amateurfußballs in der sächsischen Landeshauptstadt hält, der irrt gewaltig. Auch wenn das schwarz-rote Vereinswappen heute nur noch eine Mannschaft aus der siebtklassigen Sächsischen Landesklasse Ost ziert, gibt es eine lange Historie rund um das Ostragehege. Obwohl die Gegner heutzutage VfB Zittau und Fortuna Trebendorf heißen, hält man in Dresden noch einen Kultstatus.
01.09.2021 08:54:59 [Frankfurter Allgemeine Zeitung]
Tennis: Djokovic und die Jagd nach dem Kronjuwel
Novak Djokovic ist auf einer Mission. Mit einem Sieg bei den US Open würde er den Grand Slam gewinnen. Einem Mann ist das seit mehr als 50 Jahren nicht mehr gelungen. Der Discjockey im Arthur Ashe Stadium versteht seinen Job. Zwei Wochen lang verwöhnt er die Fans während der Seitenwechsel oder nach dem Ende eines Spiels, aber am meisten im Gedächtnis bleibt natürlich das, was er am Ende für den Sieger auflegt. Am 9. September 2007 entschied er sich für Tina Turner und Simply The Best, der Adressat hieß Roger Federer.
06.09.2021 08:58:49 [Deutschlandfunk]
Finanzen im Profifußball: Staatsunternehmen als Sponsor
Vom großen Player Telekom über diverse Lottogesellschaften bis hin zu kommunalen Energieversorgern: Sie alle setzen als Unternehmen mit staatlicher Beteiligung Steuergelder für das Sponsoring von Fußball-Bundesligisten ein. Ist dieses Sponsoring ähnlich zu bewerten wie Bürgschaften von Bundesländern und staatliche Beihilfen für Fußballvereine? Professor Tim Ströbel von der Universität Bayreuth hofft nicht, dass das Gefälligkeiten sind: „Im Sportsponsoring ist man ja gerade darum bemüht, sich abzugrenzen von so etwas wie ein Mäzenatentum oder eben irgendwelchen Gefälligkeitsleistungen.“
06.09.2021 09:00:33 [Junge Welt]
»Dynamo Dresden ist, wenn man trotzdem lacht«
Über modernen Fußball, mehr Biere als Tore und den Ruf des Dresdner K-Blocks. Ein Gespräch mit Spuckelch: In welchem Habitat bewegt sich ein Spuckelch, und wie kam er zu seinem Namen?

Gemäßigter Dynamofanatiker, der im Laufe der Jahre gelernt hat, die SGD und ihr Umfeld voller Wahnsinniger und Intellektueller, Rechts-nicht-Abgeneigter und Antirassisten, Gutmenschen und besorgter Bürger, Spießer und Hipster nicht allzu ernst zu nehmen. Motto: Dynamo Dresden ist, wenn man trotzdem lacht. Über sich selbst lachen ist vielen Dresdnern nicht unbedingt in die Wiege gelegt.

06.09.2021 09:02:58 [Neues Deutschland]
Paralympics: Was bleibt von »Tokyo 2020«?
So beliebt waren die Paralympischen Spiele nie zuvor: Mindestens 4,25 Milliarden Menschen in rund 150 Ländern haben die größte Behindertensportveranstaltung der Welt im TV gesehen. Auch mit den ungefähr 4400 Sportlern, die nach Tokio reisten, wurde ein Rekord erreicht. Trotz Pandemie haben die Paralympics ihren jahrzehntelangen Wachstumskurs fortgesetzt. Und das in Japan, das bisher nicht gerade als Hochburg des Parasports bekannt war. Im ostasiatischen Land sollten die Paralympics nicht zuletzt für mehr Wertschätzung von Diversität sorgen. Die Barrierefreiheit sollte verbessert und die Sichtbarkeit von Menschen mit einer Behinderung erhöht werden.
06.09.2021 09:04:23 [Zeit Online]
Warum der Ronaldo-Transfer keinen Sinn hat
Lukaku, Sancho, sogar Ronaldo und Messi – es war viel los auf dem Transfermarkt. Corona kann den großen Clubs nichts anhaben. Sportlich hilfreich ist das immer seltener. Es sind imposante Zahlen, die die Fifa diese Woche bekannt gab: Gemäß einer Studie stiegen die globalen Ablösesummen im Männerfußball in den Zehnerjahren um das Dreifache. Die Zahl der jährlichen Transfers stieg dabei von 11.890 im Jahr 2011 auf 18.079 im Jahr 2019. Insgesamt flossen in dieser Zeit 48,5 Milliarden Dollar, etwa die Hälfte entfiel auf die dreißig reichsten Vereine aus Europa. Auch Zahlungen an Berater erhöhten sich entsprechend (im Gegensatz zu Ausbildungsentschädigungen für kleine Vereine, die stagnierten).
06.09.2021 09:06:22 [Süddeutsche Zeitung]
Die Drei von der Tennisanlage
Alexander Zverev, Peter Gojowczyk, Oscar Otte. Drei Männer aus Deutschland im Achtelfinale eines Grand-Slam-Turniers, das hat es seit 1997 (Boris Becker, Michael Stich und Nicolas Kiefer in Wimbledon) nicht mehr gegeben. Zwei Vertreter sind große Überraschungen, und es entbehrt nicht einer gewissen Ironie, dass der dritte beinahe eine große Überraschung erlebt hätte: Zverev spielte am Samstagabend im Arthur Ashe Stadium gegen Jack Sock und hatte im ersten Satz so was von keine Chance gegen die präzisen Aufschläge und die peitschende Vorhand des Gegners.
06.09.2021 09:07:57 [Deutschlandfunk]
100 Jahre ISTAF: „Es sind nicht die Weltrekorde, die zählen, sondern der Wettkampf“
Am 3. Juli 1921 fiel der erste Startschuss für das ISTAF – damals noch im Deutschen Stadion in Berlin. Erst seit 1937 hat es seinen festen Platz im Berliner Olympiastadion und auch dort musste für manche Athleten schon mal nachgebessert werden, erinnert sich Gerhard Janetzky, ehemaliger Chef des Meetings, im Dlf:

„In einer Nacht- und Nebelaktion haben wir mit der Harke die Weitsprunggrube um einen Meter verlängert.“ Denn damals hatte sich ein sehr guter Weitspringer angekündigt, dem die Grube für seine Sprünge zu kurz gewesen ist.

Dass so gute Athleten am ISTAF teilnehmen, daran war 2002 nicht zu denken.

06.09.2021 09:09:22 [Qantara]
Saudi-Arabien: Kicken für Frauenrechte
Saudi-Arabiens Frauen haben in den vergangenen Jahren neue Freiheiten bekommen. Jetzt erobern sie Schritt für Schritt auch den Sport. Mit deutscher Hilfe soll bald eine FrauenFußballnationalelf auflaufen. Als Fußballtrainerin hat Monika Staab einiges von dieser Welt gesehen. In rund 80 Ländern war sie schon im Einsatz, um Frauen das Fußballspielen beizubringen.

Doch die Aufgabe, die die frühere Spielerin an diesem Mittwoch übernimmt, ist selbst für sie etwas Besonderes: Denn Monika Staab übernimmt als Coach die allererste Frauen-Fußballnationalelf Saudi-Arabiens.

06.09.2021 09:11:27 [Racing Blog]
Formel Eins: Analyse GP der Niederlande
Max Verstappen gewann den Grand Prix der Niederlande. Vor der fantastischen (aber unter Corona-Gesichtspunkten bedenklichen) Kulisse von 70.000 Zuschauern dominierte der Fan-Favorit zwar nicht nach Belieben, wirklich gefährdet war sein Sieg allerdings auch nie. Bevor ich zur Performance der einzelnen Teams komme, seien ein paar allgemeine Worte zur Strecke gesagt beziehungsweise geschrieben. Die Mischung aus Hot-Wheels-Strecke und Kartbahn funktioniert… für circa 20 Minuten. Dann “normalisiert” sich die Strecke beim Betrachten und man merkt (wieder), dass es dort einfach unglaublich schwer ist, zu überholen.
08.09.2021 09:03:37 [Frankfurter Allgemeine Zeitung]
Der Preis der deutschen Vernunft
Fußball ist immer Nährboden für Fantasien und große Träume. Röche das Spiel nur nach Schweiß, Erde und Bratwurst, würde etwas fehlen. Auch die erbittertsten Kommerzgegner werden zumindest verstohlen nach Paris schielen, um zu sehen, ob Messi, Mbappé, Neymar und Ramos in der bevorstehenden Champions-League-Saison ihre wunderbaren Fähigkeiten zu einer neuen kollektiven Schönheit aufblühen lassen. Fans von Manchester United protestierten im Mai wütend gegen das auch von ihrem Klub unterstützte Super-League-Projekt, jetzt jubeln sie, weil die vor wenigen Wochen noch verhassten Investoren die Rückkehr von Cristiano Ronaldo möglich machten.
08.09.2021 09:05:47 [Süddeutsche Zeitung]
Erinnerungen an Völler bei Island vs. DFB
Ob er ähnlich reagieren könnte wie einst Teamchef Rudi Völler in seiner legendären Wutrede nach einem 0:0 in Island 2003? "Es ist nicht vorstellbar, definitiv nicht", hat Bundestrainer Hansi Flick am Tag vor dem ersten deutschen Spiel in Island seit 18 Jahren in der Pressekonferenz gesagt. "Ich würde das in der Form nie machen", erklärte Flick. Aber womöglich in leicht veränderter Form?

Also: Am Mittwochabend herrscht Regenwetter in Reykjavik, im Laugardalsvöllur-Stadion weht den RTL-Kommentatoren Marco Hagemann und Steffen Freund eine ungemütliche Brise um die Nasen.

08.09.2021 09:07:46 [Zeit Online]
NFL: Wo die Impfung über den Titel entscheidet
Einige NFL-Teams sind komplett geimpft, bei anderen weigern sich Spieler. In der neuen Saison könnte die Impfquote ebenso wichtig werden wie sportliches Geschick. Kirk Cousins, der Star-Quarterback der Minnesota Vikings hatte Ende Juli einige Tage des Trainingcamps seines Teams verpasst. Er war als Corona-Risikokontakt eingestuft worden. In dieser Zeit machte er sich so seine Gedanken. "Ich habe buchstäblich überlegt, Plexiglas um meinen Sitz herum zu bauen, damit so etwas nicht noch mal passieren kann", sagte Cousins danach. "Ich habe darüber nachgedacht, weil ich alles tun werde, was nötig ist."

Eine Sache wollte Cousins dann doch nicht tun: sich impfen lassen.

08.09.2021 09:09:58 [Welt]
„Dem HSV klebt das Unvermögen an den Hacken“
Nur Platz zehn nach fünf Ligaspielen. Die sportliche Zwischenbilanz beim Hamburger SV bietet eine erneute Steilvorlage für die zahlreichen Kritiker, die schon den Abstieg des einstigen Bundesliga-Dauergastes und die drei verpatzten Wiederaufstiegsversuche im Anschluss mit ihren Kommentaren begleitet haben. Einer von ihnen ist Geldgeber Klaus-Michael Kühne, der den Traditionsverein in den letzten Jahren immer wieder vor dem finanziellen Ruin bewahrte.

„Die Ergebnisse haben die Begeisterung doch ziemlich abflauen lassen“, gab der 84-Jährige in einem Interview mit dem Hamburger Abendblatt zu.

08.09.2021 09:12:46 [Süddeutsche Zeitung]
US Open:v Zwei rechnen, einer wartet auf Djokovic
Peter Gojowczyk und Oscar Otte sind nach ihren Achtelfinal-Niederlagen in New York vor allem mit den Corona-Regeln der Tennis-Weltrangliste beschäftigt - Alexander Zverev hat nach seinem Viertelfinal-Einzug ganz andere Sorgen. Nein, sie sah nicht gut aus, die Hand von Oscar Otte. Er war während der Partie gegen den Italiener Matteo Berrettini gestürzt, hatte seinen Auftritt deshalb lädiert beendet und sagte danach, dass er sich unter der Dusche nicht einmal habe einseifen können. Immerhin: Die Röntgenaufnahmen zeigten keinen Bruch. Vor dem kapitalen Sturz nach einem Schmetterball an der Grundlinie zu Beginn des vierten Satzes war er schon einmal übers Netz gefallen und einmal gefährlich unter die Bank am Seitenrand gerutscht.
08.09.2021 09:14:41 [Junge Welt]
Fußball: Der Effzeh den Mitgliedern
Ein Gespenst geht um in Köln – das Gespenst des Investors. Als die Vereinsführung des 1. FC Köln ihre Mitglieder zum Diskussionsabend am vorigen Sonntag einlud, staunten die Fans nicht schlecht. Nicht etwa der Umgang mit der Coronapandemie oder die neue Schiebermütze von Übungsleiter Steffen Baumgart sollten diskutiert werden, sondern der »Einstieg von Investoren bei den Vereinen«. Dass sich die Vereinsführung nun für die Meinung von Fans interessiert, kommt unerwartet – zu oft war das Tischtuch in Köln-Müngersdorf schon zerschnitten. Und das, obwohl der Vorstand des Bundesligisten immer wieder betont, dass der Verein mitgliedergeführt und von Investoren unabhängig bleiben soll. Bei den Traditionalisten schrillen die Alarmglocken.
09.09.2021 08:59:48 [Welt]
Tennis: Eine 19-jährige Kanadierin verzaubert die US Open
Zum ersten Mal steht Leylah Fernandez in einem Grand-Slam-Viertelfinale - mit gerade einmal 19 Jahren. Die Kanadierin überzeugt die Fans bei den US Open mit spektakulärem Power-Tennis. Hinter dem Erfolg steckt ein Familienunternehmen. Und Ahornsirup. Nach ihrem nächsten Tennis-Coup bei den US Open sank Leylah Fernandez erst einmal auf die Knie. Ungläubig schlug sie unter dem Jubel der Zuschauer im Arthur-Ashe-Stadium die Hände vors Gesicht und war überwältigt von der Tatsache, bei den US Open im Halbfinale zu stehen.
09.09.2021 09:02:19 [Zeit Online]
Nationalmannschaft: Läppischer Schuss, Abend gerettet
Island – Deutschland 0:4 (0:2). Timo Werner, der Mann der Fehlpässe und Drüberschüsse, hat es seinen Kritikern gezeigt. Bei seinem Siegestor gegen Island muss die Hilfe von Elfen im Spiel gewesen sein. Timo Werner, der schnelle deutsche Mittelstürmer, der nicht alle Fans immer vollends überzeugt. Auch diesmal sah man von ihm Abseitsstellungen, Fehlpässe, steife Ballmitnahmen, den üblichen Drüberschuss aus sechs Metern. Auf Twitter steckte er mit seinen Fehlversuchen in puncto Häme locker Armin Laschet in die Tasche. Doch dann, in der 88. Minute, kam Werner die Physik zu Hilfe.
09.09.2021 09:05:20 [Süddeutsche Zeitung]
Die unterschätzteste Zweitgesetzte der Grand-Slam-Geschichte
Kaum jemand hat Aryna Sabalenka als US-Open-Siegerin auf dem Zettel, selbst vor dem Halbfinale reden die meisten über ihre Gegnerin. Eine Anpassung ihrer Spielweise könnte dafür sorgen, dass sich das ändert. Der erste Tipper auf die Grundlinie, die nächsten drei im Feld, dann schlägt sie auf - außer vor wichtigen Punkten, da können es insgesamt auch fünf Tipper sein. Wenn sie bei gegnerischem Aufschlag einen Ballwechsel gewonnen hat, starrt sie auf die Wand hinter sich, tippelt ein wenig und übt jeweils Vor- und Rückhand; nach Punktverlust lässt sie das mit den Schwüngen lieber.
09.09.2021 09:07:28 [N-TV]
Alle zwei Jahre eine WM? Widerstand gegen FIFA-Revolution bröckelt
Die FIFA ruft und alle kommen. Am Donnerstag und Freitag soll in Katar über die Zukunft des Fußballs beraten werden. Etliche Stars verleihen dem Treffen Glanz. Eines der bestimmenden Themen der Konferenz dürfte die geplante WM-Revolution werden. Noch gibt es Widerstand aus Europa, doch der bröckelt.

Im erbitterten Ringen um ihre WM-Revolution fährt die FIFA ganz große Geschütze auf. Ronaldo, Didier Drogba und Marco van Basten, aber auch den deutschen Weltmeister Sami Khedira oder Brasiliens Roberto Carlos - sie alle hat der Weltverband in Doha zusammengerufen. Zwei Tage lang sollen die Stars offiziell über die "Zukunft des globalen Fußballs" beraten.

09.09.2021 09:10:57 [Frankfurter Allgemeine Zeitung]
Djokovic gegen Zverev: Die Olympia-Revanche steigt im Halbfinale
Sechs Wochen nach der Niederlage im Halbfinale der Olympischen Spiele bekommt Novak Djokovic bei den US Open die Chance zur Revanche gegen Alexander Zverev. Die Nummer eins der Tennis-Weltrangliste gewann in der Nacht zu Donnerstag (Ortszeit) das Viertelfinale gegen den Italiener Matteo Berrettini 5:7, 6:2, 6:2, 6:3 und trifft nun wie in Tokio in den Semifinals auf Deutschlands besten Spieler. Djokovic will sich mit einem Sieg gegen Zverev und dem Einzug ins Finale die Chance auf den Grand Slam erhalten. Die Australian Open, Wimbledon und die French Open hat er 2021 bereits gewonnen, die Pokale aller großen Turniere in einem Jahr holte sich zuletzt der legendäre Rod Laver 1969.
09.09.2021 09:12:14 [Junge Welt]
American Football: Protest unerwünscht
An diesem Donnerstag beginnt die 102. Saison der National Football League in den USA mit dem Spiel des Titelverteidigers Tampa Bay Buccaneers gegen die Dallas Cowboys. Auch in Europa erfreut sich American Football mittlerweile immer größerer Beliebtheit. Politisch interessierte Fans verbinden mit dem Sport vor allem einen Namen: Colin Kaepernick.

Im Sommer 2016 weigerte sich der Quarterback der San Francisco 49ers, bei Testspielen während der obligatorischen Darbietung der Nationalhymne vor der US-amerikanischen Flagge aufzustehen.

11.09.2021 09:13:23 [Neues Deutschland]
Bayern lässt jetzt Leipzig bluten
Eines wollte der FC Bayern am Donnerstag noch einmal klarstellen. Der Klub schwäche nicht gezielt seine Gegner, meinte Oliver Kahn. Von kraftstrotzender Konkurrenz kann angesichts von neun Münchner Meisterschaften in Folge zwar keine Rede sein. Der Vorstandvorsitzende sagte dies jedoch bei der Vorstellung von Marcel Sabitzer. Der 27-jährige Mittelfeldspieler war der vierte und letzte Neuzugang des Klubs in diesem Sommer. Gekommen war er aus Leipzig – und trug in dieser Saison sogar schon in zwei Bundesligaspielen das Trikot von RB.
11.09.2021 09:16:24 [Frankfurter Allgemeine Zeitung]
Fußball-WM alle zwei Jahre? : „Dieser Plan würde den Fußball töten“
Die große Gemeinde der Fußballfreunde in Europa scheint sich an immer gewagtere Reformvorschläge inklusive anschließender Empörungswellen gewöhnen zu müssen. Im Frühjahr sorgten die Super-League-Pläne einiger Großklubs für Fassungslosigkeit, und jetzt wird über die Idee diskutiert, von 2028 an Weltmeisterschaften im Zweijahrestakt auszutragen. Der Internationale Fußballverband FIFA mit seinem Präsidenten Gianni Infantino hat einen entsprechenden Reformvorschlag für den Fußballkalender vorgelegt, sicher nicht zuletzt getrieben von der Idee, noch mehr Geld verdienen zu können.
11.09.2021 09:19:02 [Hertha Base]
VfL Bochum – Hertha BSC: Mit Druck in den Pott
Und täglich grüßt das Murmeltier. Nachdem Hertha nun im dritten Jahr hintereinander den Saisonstart gehörig in den Sand gesetzt hat, steht man bereits nach dem dritten Spieltag schon wieder unter Druck. Der katastrophale Deadline Day trägt nicht gerade dazu bei, dass die Hoffnungen auf einen erfolgreicheren Saisonverlauf als letztes Jahr ins Unermessliche steigen. Umso entscheidender werden nun die beiden folgenden Spiele gegen die Aufsteiger aus Bochum und Fürth. Castroper Straße, Grönemeyer, Flutlicht. Fußballromantikern dürfte landesweit das Herz aufgegangen sein, als mit dem VfL ein echtes Urgestein der Bundesliga nach elfjähriger Abstinenz zurückgekehrt ist.
11.09.2021 09:22:04 [Neues Deutschland]
Straßenrad-EM: Große Namen in Trient
Die Straßenrad-EM gewinnt mehr und mehr an Bedeutung: Am Sonntag steht das Einzelrennen der Männer an. Sie mausern sich langsam zu einer bedeutsamen Veranstaltung, die Radsporteuropameisterschaften, die in dieser Woche im italienischen Trient ausgetragen werden. Dazu trägt in diesem Herbst auch ein beachtliches Star-Aufgebot bei. Der zweifache Tour-de-France-Sieger Tadej Pogacar (Slowenien) geht an den Start, der frühere Tourzweite Romain Bardet (Frankreich) ebenso. Auch der slowakische Ex-Weltmeister und Ex-Europameister Peter Sagan hat für das Straßenrennen zugesagt, außerdem das belgische Toptalent Remco Evenepoel.
11.09.2021 09:25:48 [Süddeutsche Zeitung]
US Open: Zverev verliert gegen Djokovic
Alexander Zverev gewinnt gegen Novak Djokovic im Halbfinale der US Open zwei Sätze - aber nicht mehr. Der Serbe, der am Sonntag gegen Daniil Medwedew den Grand Slam komplettieren kann, begibt sich während der Partie an einen Ort, an dem ihn niemand erreichen kann. Es war überhaupt noch nichts passiert zu Beginn des fünften Satzes, und doch lag da ein Geruch über dem Tennisplatz im Arthur Ashe Stadium. Novak Djokovic, der sich bekanntermaßen gerne mit einem Wolf vergleicht, erschnuppert so was, und er zeigt das seinem Gegner. Alexander Zverev hatte beim Stand von 15:15 nur seinen ersten Aufschlag versemmelt, da rückte Djokovic zwei Meter weiter nach vorne, als er das vorher getan hatte; und plötzlich rochen es auch Zverev und die Leute in den ersten Reihen: Jetzt wird was passieren, und es passierte auch was.
14.09.2021 08:57:45 [Neues Deutschland]
Sportler gegen Touristen
Die Internationale des guten, schönen und aufregenden Fußballs spielt am Mittwoch in Brügge auf - im Stade Jan Breydel, wo der neureiche Paris Saint-Germain FC in die Saison der Champions League startet. Vor gar nicht so langer Zeit hätte das niemanden jenseits von Brügge und Paris interessiert. Erst recht nicht in Barcelona, der traditionellen Heimat des guten, schönen und aufregenden Fußballs. Am Mittwoch aber geben Lionel Messi, Neymar und Kylian Mbappé bei Club Brügge ihre gemeinsame Antrittsvorstellung. Wer will das schon versäumen?
14.09.2021 08:59:27 [Frankfurter Allgemeine Zeitung]
So teuer werden Champions League und Co.
Fans des Fußball-Europapokals müssen in der neuen Saison viel Geld ausgeben. Um die freie Auswahl bei Champions League, Europa League und Conference League zu haben, die in dieser Woche mit der Gruppenphase starten, sind drei Abonnements notwendig. Das ZDF darf wieder bewegte Bilder von der Königsklasse zeigen. Bis 2018 hatte der Sender sechs Jahre lang eine Partie pro Spieltag gezeigt, jetzt darf das Zweite die Endspiele live übertragen und zudem Höhepunkte.
14.09.2021 09:01:51 [Schwatzgelb]
„Zurück zu vollen Stadien“ – ja, aber wie?
Kommentar zu den Stellungnahmen von "Südtribüne Dortmund". Als ich nach über 18 Monaten beim Heimspiel gegen Eintracht Frankfurt wieder das Westfalenstadion betrat, machte sich in mir ein diffuses Gefühl aus Vertrautheit und gleichzeitiger Fremdheit in mir breit. Sicher: es gab kleine Momente, da ging der Kopf für einen Augenblick aus und die bekannten Emotionen, die man bereits hundertfach erlebt hat, nahmen Überhand. Die meiste Zeit beherrschte allerdings der Verstand die Gefühlswelt: dieses Stadionerlebnis ist nicht so, wie es eigentlich sein sollte.
14.09.2021 09:03:56 [Süddeutsche Zeitung]
US Open: Djokovic hat verloren, aber wird endlich geliebt
Der Serbe bricht während des US-Open-Endspiels in Tränen aus - weil ihm die Zuneigung der New Yorker zuteilwird. Gut möglich, dass Djokovic diese Niederlage mehr bedeuten wird als seine Triumphe. Das Finale der US Open war längst nicht vorbei, die 25.703 Leute im Arthur Ashe Stadium waren wild entschlossen, Novak Djokovic noch zum grandiosesten Comeback der Tennisgeschichte zu brüllen; krasser als das Wimbledon-Achtelfinale 1987, als Jimmy Connors (USA) einen 1:6, 1:6, 1:4-Rückstand gegen Mikael Pernfors aufholte. Djokovic wusste jedoch, beim Stand von 4:6, 4:6, 4:5 und obwohl er davor ein Break geschafft hatte, dass es vorbei war - und er lächelte, als er bemerkte, wie sehr die Zuschauer ihn anfeuerten.
14.09.2021 09:05:18 [Neues Deutschland]
Die letzten Skrupel sind fort
Eigentlich braucht die Champions League keine rührige Werbetrommel. Längst ist die Königsklasse ein sich selbst vermarktendes Produkt mit weltweiter Strahlkraft. Gleichwohl setzt die Europäische Fußball-Union (Uefa) über ihre Kanäle zwei der prägendsten Figuren ihres wertvollsten Wettbewerbs jetzt kraftvoll in Szene: Kylian Mbappé (Paris St. Germain) und Kevin De Bruyne (Manchester City) stehen im Mittelpunkt einer Dokumentation, die in der K.o.-Phase der vergangenen Spielzeit entstand - und an deren Ende weder der eine noch der andere den Henkelpott gewann.
15.09.2021 15:28:22 [Zeit Online]
Schumacher: Über das Leben eines Perfektionisten
"Schumacher" läuft ab dem 15. September auf Netflix. Das Besondere an Michael Schumacher ist nicht, dass er das beste Auto am schnellsten ins Ziel bretterte. Er gewann auch mit unterlegener Technik. Empfehlung einer Doku: Wagt man sich an eine Sportler-Dokumentation, ist es immer auch eine Reise in die eigene Vergangenheit. Man erinnert sich an Tennismatches von Boris Becker, an Siege von Henry Maske, an Niederlagen von Axel Schulz. Eine solche Reise, sie ist immer emotional, man verklärt vieles, früher war ja nicht alles besser, nur anders. Und doch sind solche Momente üblicherweise ein großes Geschenk.
16.09.2021 09:10:34 [TAZ]
Die Niederungen des Fußballs
Profifußball ist zu absurd geworden, aber die Regionalliga Nordost ist noch einmal ein ganz besonderer Fall. Man könnte Verschwörungen vermuten. Vielleicht werde ich paranoid, oder es ist tatsächlich eine riesige Verschwörung im Gange. Als ich aufhörte, mich für die höheren Ligen des Profifußballs zu interessieren, weil mir allzu viel daran lächerlich und zynisch erschien, unterbrach Corona den Spielbetrieb der unteren Ligen; seit dieser Saison läuft die Regionalliga Nordost wieder. Aber seitdem tut die Liga, was sie kann, um mir mein zartes Interesse wieder zu verleiden.
16.09.2021 09:12:14 [Junge Welt]
Olympia: Ein gnädiges Ende?
Zukunft des DOSB: Forderungen nach erneuter organisatorischer Trennung von Spitzen- und Breitensport werden lauter. Freiberufler, wie sie zum Beispiel im Bereich der Öffentlichkeitsarbeit mitwirken, sind mit den Sparzwängen beim Dachverband des deutschen Sports bestens vertraut. Was den Deutschen Olympischen Sportbund (DOSB) nicht daran hindert, regelmäßig größere Summen für externe Berater auszugeben. Oder wie ganz aktuell für Headhunter, um geeignete Kandidaten für die Nachfolge von Präsident Alfons Hörmann zu finden. Für den Mann, der seit 2013 an der Spitze steht, ist nach heftiger Kritik an seinem Führungsstil unfreiwillig schon ein Jahr vor Ablauf seiner offiziellen Amtszeit Schluss.
16.09.2021 09:13:40 [Süddeutsche Zeitung]
CHIO in Aachen: Für die Rettung des Reitens
Hans-Joachim Erbel ist neuer deutscher Reitsport-Präsident - ein Amt, das kaum einer übernehmen will. Der Neue will nun dafür sorgen, dass es diesen Sport auch in 20 Jahren noch gibt. Ein bisschen zaghaft noch betritt Hans-Joachim Erbel den roten Teppich , der zum Vip-Palast des CHIO Aachen führt. Am liebsten wäre er hintenherum gegangen, hinter der Wand, vor der Fotografen auf die Prominenz warteten, die zum Champagnerempfang vorfuhr. Aber das gehe jetzt nicht mehr, bedeutet ihm der Generalsekretär der Deutschen Reiterlichen Vereinigung (FN), Sönke Lauterbach. Erbel ist seit wenigen Monaten neuer Präsident des Reiterverbandes. "Der neue Breido", so stellt Lauterbach seinen Chef vor, und dann wissen alle, was gemeint war.
16.09.2021 09:15:12 [Frankfurter Allgemeine Zeitung]
Die Krise des FC Barcelona: Wie wäre es mit Realismus?
Die Verfallsgeschichte des FC Barcelona lässt sich als beispielloses europäisches Finanzdesaster erzählen, aber am Ende führen alle fatalen Rechenfehler und aufgeblähten Bilanzen doch wieder zum grünen Rasen zurück, auf dem am Dienstagabend, zum Auftakt der Champions League und für alle sichtbar, das kleinste, graueste und hasenherzigste Barça-Team der letzten fünfzehn Jahre stand: drei Innenverteidiger, um den Ansturm des FC Bayern zu erwarten; zwei neue Niederländer in der Offensive, um Messi und seine Kollegen vergessen zu machen, auch wenn niemand weiß, wie das gehen soll; und ansonsten alle Mann hinter dem Ball.
16.09.2021 09:17:29 [Vertikalpass]
Das Ende einer kurzen Zweck-Ehe
Achteinhalb Wochen sind seit der Mitgliederversammlung vergangen. Achteinhalb Wochen trügerische Ruhe. Achteinhalb Wochen Hoffnung, dass sich Claus Vogt und Thomas Hitzlsperger zusammen raufen könnten. Mit der Bekanntgabe, dass „Hitz“ seinen Vertrag als Vorstandsvorsitzender der VfB AG nicht verlängert, ist die Hoffnung auf Ruhe und Kontinuität vorbei. Die Personalie Hitzlsperger ist untrennbar mit dem Vereinspräsidenten und AG-Aufsichtsratsvorsitzenden Vogt verbunden. Offensichtlich sieht Hitzlsperger keine Basis für eine gute Zusammenarbeit, offensichtlich hat er andere Vorstellungen als Vogt, wenn nicht – so zu vermuten seit dem Dezember 2019 – unüberbrückbare Differenzen vorliegen.
16.09.2021 09:19:06 [Süddeutsche Zeitung]
Champions League: Ein Wettbewerbsvorteil für die Bayern
An Europas Spitze abgehängt? Die Münchner liefern die Gegendarstellung zur These ihres eigenen Trainers. Der FC Bayern hat nicht nur Barcelona etwas voraus, sondern auch den wirtschaftlich potenteren Klubs. Als Karl-Heinz Rummenigge noch für den FC Bayern verantwortlich war, also kürzlich, da gab er ein Interview, in dem er sich mit einem düsteren Satz zitieren ließ. "Der deutsche Fußball", meinte Rummenigge (und darunter hat er's ja nie gemacht), der deutsche Fußball also müsse aufpassen, "international nicht abgehängt zu werden". Nicht viel später saß der neue Trainer des FC Bayern, Julian Nagelsmann, auf einem Pressepodium und sagte, ja, es bestehe "die Gefahr, international abgehängt zu werden".
16.09.2021 09:20:37 [Junge Welt]
Fußball: Schlecht oder sehr schlecht
Eine Fußball-WM alle zwei Jahre? Für den deutschen Sport sind die FIFA-Pläne ein Schreckgespenst. Etwa für den Handballtopfunktionär Hans Robert Hanning. »Es besteht die Gefahr, noch mehr vom Fußball erdrückt zu werden. Uns wird die Luft zum Atmen genommen«, sagte er am Mittwoch gegenüber sid. Auch das Internationale Olympische Komitee (IOC) beobachtet die Expansionspläne von FIFA-Präsident Gianni Infantino mit Argwohn. Grundsätzlich sei es Sache der FIFA und der Kontinentalverbände, sagte IOC-Präsident Thomas Bach, doch man verfolge die Diskussionen und finde sie »sehr interessant«.
16.09.2021 09:22:07 [Kontext Wochenzeitung]
VfB auf Schmusekurs: Umarme deinen Feind
Auch nach der Sommerpause steht der deutsche Fußball vor der zentralen Frage: Kurve oder Kapital? Geplant war eigentlich, nach der Sommerpause, nach Kurzurlaub und Kopfleerung mal eine Weile nichts mehr über den VfB Stuttgart zu schreiben. Die Mannschaft hat die Klasse gehalten, spielt weiter in der Bundesliga, im Team scheint es zu stimmen, die sportliche Führung konzentriert und super solide, Transferphase im Sommer auch okay, und die einstmals verfeindeten Gremien in Verein und AG veröffentlichen Kuschelbilder ihrer höchst harmonischen gemeinsamen Klausur in Ludwigsburg.
16.09.2021 09:23:23 [Der Freitag]
Schön Wahnsinnig
Lionel Messi wechselt mit 34 Jahren zu Paris Saint-Germain. Das ist wunderbar, gerade weil es jeglicher Logik entbehrt. Der FC Barcelona hat geweint, weil dieser stolze katalanische Klub seelischen Schmerz verspürt, doch nüchtern und sportlich betrachtet ist es eine gute Sache, dass Lionel Messi nicht mehr für „Barça“ Fußball spielt. Die moderne Datenerfassung ist mit dem argentinischen Superstar unerbittlich gewesen, sie hat ihn überführt, hat festgestellt, dass er in manchen Spielen nur sieben oder acht Kilometer gelaufen ist. Geringfügig mehr als die Strecke, die ein moderner mitspielender Torwart wie Manuel Neuer in eineinhalb Stunden zurücklegt.
16.09.2021 09:24:44 [Schwatzgelb]
Matchwinner im falschen Trikot
In Bellingham verliebt, von Cramer und Co. verarscht – Der BVB startet siegreich in die Champions League.

Früher waren Champions-League-Spieltage mal was Besonderes. Durch den aufgeblähten Spielplan und die immer gleichen finanzstarken Teams, die es bis in die Viertel- und Halbfinals schaffen, verliert aber auch dieser Wettbewerb an Wert. Und so war es auch nur ein Spieltag, der sich in der Vorfreude nicht von einem stinknormalen Bundesliga-Kick unterscheidet.

Zwar startete die Mannschaft von Trainer Marco Rose zunächst etwas schläfrig in die Partie, stellte die Weichen jedoch frühzeitig auf Sieg.

 Wirtschaft, Ökonomie, Finanzen, Finanz- und Wirtschaftskrise, Geldsystem, Währung, Banken (64)
01.09.2021 09:01:59 [Telepolis]
Mietpreisbremse vs. Mietendeckel
Nachrichten aus dem bundesdeutschen Kapitalismus (Teil 2): Oft meinen Politiker es einfach nur gut. Immer dann, wenn sie sich den vielfältigen Problemen der unter ihrer Ordnung lebenden Menschen widmen und bemerken, dass es hier und da so nicht weitergehen kann, und sie feststellen, dass diese Probleme von einer allgemeinen Art und Tragweite sind, die am Ende dem Staat selbst noch viel mehr Probleme bereiten könnten, sind sie mit ihrer Regierungskompetenz gefragt und schreiten zur Tat.
01.09.2021 11:10:46 [Junge Welt]
Leitwährung US-Dollar: Angst vor Spekulationswut
Treffen der Notenbanker in Jackson Hole: Federal Reserve stellt Straffung von Geldpolitik noch 2021 in Aussicht. Spekulanten drängeln schon: Wann werden sie wieder Zinsen für ihr Geld erhalten? Auf dem Treffen der Notenbanker am vergangenen Wochenende, das üblicherweise im US-amerikanischen Jackson Hole stattfindet, aber wegen der Pandemie nur online abgehalten wurde, stand die Frage eines Ausstiegs aus der expansiven Geldpolitik im Zentrum der Diskussion.
01.09.2021 14:25:17 [Junge Welt]
Bürgerliche Propaganda: Paradies für Reiche
Die Bürgerlichen zittern. Denn Deutschland droht ein »Linksrutsch« – so lautet zumindest die offizielle Propaganda von CDU/CSU und Unternehmern seit einigen Tagen. Am Montag stimmte nun auch das Ifo-Institut in den Kanon ein und warnte vor der Einführung einer Vermögenssteuer, wie sie SPD, Grüne und Die Linke planten. Das Bruttoinlandsprodukt (BIP) »wäre nach acht Jahren mit Vermögensteuer um bis zu 6,2 Prozent niedriger als ohne«, schrieb Ifo-Präsident Clemens Fuest in einer Studie für die »Stiftung Familienunternehmen«.
01.09.2021 14:39:36 [German Foreign Policy]
Klimaschutz als profitabler Exportschlager
Führende Wirtschaftsinstitute sowie wachsende Teile der Berliner Politik sehen in Umwelttechnologien ein künftiges Zugpferd der deutschen Exportindustrie. Schon im Jahr 2030 könne die Bundesrepublik "Vollversorgung" mit erneuerbaren Energien erreichen, heißt es in einer aktuellen Stellungnahme des Deutschen Instituts für Wirtschaftsforschung (DIW). Dabei gelte es, den "Klimaschutz zum Exportschlager" zu machen, fordert Christian Lindner, Vorsitzender der Wirtschaftspartei FDP: Der Klimaschutz sei "das nächste Wachstums-, Fortschritts- und Investitionsthema für die ganze Welt". Warnend äußert sich in einer neuen Studie das unternehmernahe Institut der deutschen Wirtschaft (IW) aus Köln.
01.09.2021 18:06:27 [Makronom]
Warum eine Kreislaufwirtschaft notwendig und umsetzbar ist
Wir leben und wirtschaften innerhalb eines Systems, dass auf ein stets anhaltendes Wachstum ausgelegt ist. Dieses Streben nach Wachstum hat unmittelbar die Ausbeutung natürlicher Ressourcen zur Folge. Genauer ausgedrückt, ist ein Wirtschaftswachstum ohne die Ausbeutung von natürlichen Ressourcen nicht realisierbar. Einem konsequenterweise stets steigenden Trend folgend, wurde bereits 2017 ein Extraktionsvolumen von 92 Milliarden Tonnen erreicht. Zum Vergleich: 1917 waren es 27 Milliarden Tonnen. Im selben Zeitraum wuchs das Bruttoinlandsprodukt (BIP) pro Kopf von 5.198 auf 10.606 US-Dollar: Während sich also das BIP pro Kopf mehr als verdoppelte, wuchs der globale Materialverbrauch um zwei Drittel.
01.09.2021 18:08:42 [Blätter]
Boden und Wohnungen: Eldorado der Kapitalverwertung
Vor allem in wirtschaftsstarken Ballungsräumen schießen die Grundstücks- und Wohnungspreise in immer neue Höhen. Damit werden gleichzeitig bezahlbare Wohnungen zur Mangelware. In vielen Städten kämpfen Mieterinitiativen und vielgestaltige Bündnisse gegen Luxussanierungen und für bezahlbaren Wohnraum; in Berlin hat die Initiative „Deutsche Wohnen & Co. enteignen“ erfolgreich für einen Volksentscheid mobilisiert, der darauf abzielt, die Wohnungsbestände großer profitorientierter Wohnungsbauunternehmen mit einem Bestand von mehr als 3000 Wohnungen gegen eine Entschädigung zu enteignen und in Gemeineigentum zu überführen.
06.09.2021 06:49:34 [Wirtschaftliche Freiheit]
Die Versorgungsausgaben für Beamte kommen nicht
Auch in diesem Wahlkampf wollen die meisten Parteien das Thema gesetzliche Rentenversicherung nur mit Samthandschuhen anfassen; notwendige Reformen für eine nachhaltige Finanzierung umgehen sie in großem Bogen. Und das Thema Beamtenpensionen findet in den Wahlprogrammen so gut wie keine Beachtung – von dem ewig wiederkehrenden Vorschlag, Beamte in die gesetzliche Rentenversicherung einzahlen zu lassen, einmal abgesehen.

Das mag verwundern, denn ausgerechnet zu diesem Bundestagswahlkampf treten mehr Beamte in den Ruhestand ein als jemals zuvor in der Geschichte der Bundesrepublik.

06.09.2021 07:17:01 [Wirtschaftswunder]
Inflationspanik bei Friedrich Merz und Co.
Wie Deutschland gefühlt in die Hyperinflation abglitt – und dann doch noch knapp überlebte. Ein Entspannungs-Leitfaden für Preisneurotiker. Um eins vorwegzunehmen: Verglichen mit der Zeit vor einem Jahr ist eine ganze Menge in Deutschland gerade spürbar teurer. Damals war gerade die Mehrwertsteuer gesenkt worden; durch die wirtschaftliche Schockstarre der Pandemie waren die Preise für Rohstoffe und damit Benzin kollabiert – und den Betrieben saß die Angst so tief, dass viele froh waren, überhaupt noch etwas umzusetzen. Da kommt man nicht auf die Idee, Preise zu erhöhen. Für Verbraucher wunderbar. Nur halt nicht ewig.
06.09.2021 07:28:34 [Tichys Einblick]
„Wir beobachten eine Blase auf dem Immobilienmarkt“
Wer in Deutschland ein Haus kaufen möchte, zahlt bis zum Vierzigfachen der jährlichen Nettokaltmiete. Schuld daran sei vor allem die Nullzinspolitik der EZB, sagen Ökonomen. Ein Frankfurter Architekt schüttelt bloß noch mit dem Kopf, wenn er über die Immobilienpreise in der Bankenmetropole spricht. „Die Leute stecken das Geld, das sie nicht auf Reisen oder in Restaurants verkonsumieren, in Bauleistungen. Sie hängen alle der Illusion an, dass die Preise ins Unermessliche steigen“, berichtet der Mann, der ein Architekturbüro mit über 20 Angestellten leitet. Er habe einen Kunden, der gerade für knapp fünf Millionen Euro ein Einfamilienhaus in Frankfurt gekauft habe.
06.09.2021 11:30:32 [Telepolis]
Bundestagswahl 2021: Nach diesem 26. September kann es für Sie teuer werden!
Es ist ein bekanntes Phänomen: Vor einer Wahl wird etwas versprochen - und nach der Wahl kommt es dann doch anders. Nun hat auch das Münchner ifo-Institut diesem Phänomen eine Studie gewidmet; speziell geht es in ihr um die Frage, wann am ehesten Steuern erhöht werden.

Bislang gebe es bei dem Thema nur eine "anekdotische Evidenz", heißt es in der Studie: Vor den Wahlen werden vonseiten der Regierungen Geschenke verteilt, um wiedergewählt zu werden, und die Opposition überschlägt sich mit Versprechen, welche Annehmlichkeiten man nach der Wahl gewähren möchte. Nach der Wahl werden dann aber Steuern angehoben.

06.09.2021 15:10:15 [Tichys Einblick]
Der Marktausblick: Störungen, Skepsis, Sturm
In China ist der Caixin-Einkaufsmanagerindex für das produzierende Gewerbe im August auf 49,2 gefallen und liegt damit jetzt unterhalb der Marke von 50, die Wachstum signalisiert. Und auch in Indonesien, Vietnam, Thailand, den Philippinen und Malaysia meldet der Datenlieferant IHS Markit aktuell Werte unter 50. Die Folgen sind auch bei uns zu spüren: In Europa ist der Auftragsbestand auf ein nie zuvor erreichtes Niveau gestiegen. „Die Lieferengpässe und der damit verbundene Preisdruck der Produzenten könnten länger andauern als zunächst erwartet“, sagt Mateusz Urban, Ökonom bei der Analysefirma Oxford Economics.
06.09.2021 17:25:08 [Telepolis]
Für wen Inflation ein Problem ist
Inflation ist in der Öffentlichkeit ständig Thema. Mal gilt sie als zu niedrig, weil Deflation droht und Käufe nicht stattfinden, weil weitere Preissenkungen erwartet werden und so die Konjunktur stockt. Mal als zu hoch, weil die Preise steigen und das Geld weniger wert wird.

Momentan ist mehr die steigende Inflation im Gespräch. Wobei weniger gefragt wird, wieso es sie gibt. Sondern vielmehr, wie hoch sie sein darf und wie man sie richtig bemisst. Von daher lohnt es sich schon, sich näher damit zu befassen.

06.09.2021 18:43:30 [Start Trading]
Bitcoin: Die Rallye festigt sich
Ab morgen ist Bitcoin offizielles Zahlungsmittel in Ecuador. Medial wird diese Meldung groß verbreitet. Dies ist für eine digitale Währung eine wichtige Entwicklung. Der Kurs reagiert schon seit geraumer Zeit positiv. Die Rallye bei Bitcoin wird jetzt immer stabiler und verfestigt sich. Diese Stärke lockt natürlich mehr Anleger an, die ebenfalls von diesem Trend profitieren wollen. Das Kursziel für die laufende Rallye steht bereits fest. Endlich wird eine digitale Währung tatsächlich auch zu einer echten offiziellen Währung. Das ist eine Art Ritterschlag für die Kryptowelt und im Besonderen für Bitcoin.
07.09.2021 07:15:51 [Tichys Einblick]
Auf der IAA buhlt die Autoindustrie um öffentliche und staatliche Zuneigung
Mit der IAA will die deutsche Autoindustrie ihr Produkt konsensfähig erhalten – und den Staat zur Hilfe motivieren. Proteste von teils militanten Umwelt- und Verkehrsaktivisten kommen dazwischen. Und die aktuellen Marktzahlen sind auch nicht berauschend. In München hat in dieser Woche die IAA Mobility begonnen, die Internationale Automobilausstellung, einst die weltgrößte Leitveranstaltung der deutschen Automobilindustrie, bis ihr China und Shanghai vor wenigen Jahren den Rang abgelaufen haben. Aber nur der Dimension, nicht der thematischen Substanz nach, was auf die gekonnte und bewährte Organisationsführung durch den Verband der deutschen Automobilindustrie (VDA) zurückzuführen ist.
07.09.2021 09:39:25 [Süddeutsche Zeitung]
Eine ziemlich reiche Branche
Die Autoindustrie fährt nach dem Corona-Jahr 2020 wieder Milliardengewinne ein und feiert neue Rekorde. Warum aber greift die Politik den Unternehmen dann noch mit hohen Subventionen unter die Arme? Die deutsche Autoindustrie hatte nicht nur gesellschaftspolitisch schon mal einen leichteren Stand. Das fängt bereits mit der Internationalen Automobil-Ausstellung in München an. Früher war die IAA das glamouröse Hochamt einer gefeierten Industrie, heute wird über die Frage diskutiert, auf welche Art von Protesten sich die Stadt vorzubereiten hat. Konstruktiv und im Dialog? Oder Eskalation und Gewalt?
07.09.2021 13:43:21 [Telepolis]
Bitcoin ist offizielles Zahlungsmittel in El Salvador
Der Bitcoin ist seit Beginn dieser Woche offizielles Zahlungsmittel in El Salvador. Vier Tage nachdem Präsident Nayib Bukele im Juni auf einer Bitcoin-Konferenz in Miami angekündigt hatte, diese Kryptowährung als gesetzliches Zahlungsmittel einzuführen, hatte er seine Entscheidung im Parlament absegnen lassen. Dank der Unterstützung seiner Regierungsmehrheit wurde das Bitcoin-Gesetz durchgewinkt.

Von 84 Parlamentsmitgliedern stimmten 62-mit Ja, lediglich neunzehn Abgeordnete mit Nein. Ein Schritt, der große Auswirkungen haben könnte, nicht nur für Wirtschaft des mittelamerikanischen Landes, sondern auch weit darüber hinaus.

07.09.2021 17:03:07 [Junge Welt]
Pharmaindustrie: Drogendealer pleite
Für die Opioidkrise in den Vereinigten Staaten werden Konzerne zur Rechenschaft gezogen: Purdue Pharma wird sogar zerschlagen. Das Unternehmen trägt maßgebliche Mitverantwortung für die Pandemie, die in den USA mittlerweile wöchentlich rund 1.300 Todesopfer fordert.

Sie hat ihren Ursprung in den 1990er Jahren. Damals begannen US-Pharmakonzerne, opioidbasierte Schmerzmittel äußerst aggressiv zu vermarkten. Die Medikamente, etwa Oxycontin (Purdue Pharma), sollten nun auch gegen chronische Schmerzen eingesetzt werden. Der Einwand, der regelmäßige Gebrauch von Opioiden führe in die Abhängigkeit, wurde beiseite gewischt – entgegen besserem Wissen.

07.09.2021 19:01:43 [Der Freitag]
„Hyperinflation nimmt kein Experte ernst“
Interview: Florian Kern erwartet keine große Geldentwertung und kann das für Laien gut erklären. Der Freitag: Herr Kern, die Inflationsrate ist im Juli mit 3,8 Prozent auf den höchsten Stand seit 1993 geklettert. Kommt jetzt die große Geldentwertung?

Florian Kern: Ich denke nicht. Bei den 3,8 Prozent im Juli 2021 handelt es sich um einen Basiseffekt: Die Inflation wird ja immer im Vergleich zum selben Monat des Vorjahres angegeben. Nun war erstens im Juli 2020 die Inflation negativ, zweitens wurde damals die Mehrwertsteuer abgesenkt, die inzwischen wieder erhöht wurde, und drittens haben sich die Energiepreise, die wegen Corona im Keller waren, wieder erholt.

08.09.2021 11:01:10 [Start Trading]
DAX-Abverkauf: Keine Zeit verlieren
Der DAX hat es den Anlegern nicht leicht gemacht. Viel zu lange wurde der DAX in der Nähe der 16.000 Punkte Marke gehalten, was unter diesen Umständen unnatürlich war. Jetzt sinken die Kurse stark. Plötzlich ist Angst im Markt. Marktteilnehmer kennen die Inflationsangst bereits, neu hinzugekommen ist jetzt die Zinsangst. Die Kurse geben deutlich nach und haben wichtige Marken unterschritten. Anleger sollten jetzt keine Zeit verlieren. Es gab eine Zeit vor der Finanzkrise, vor der Eurokrise und vor der Immobilienkrise, da wurden noch Zinsen auf der Bank bezahlt. Diese Zeit, dass es noch einen Zinsertrag für das eingezahlte Geld gab, scheint in der heutigen Zeit vollkommen unnatürlich zu sein.
08.09.2021 13:34:43 [Makroskop]
Ein Ende der lockeren Geldpolitik?
Mit der "unkonventionellen Geldpolitik" der Zentralbanken sind wir, wie Joscha Wullweber beobachtet, in eine neue Ära eingetreten sind, die er treffend als Zentralbankkapitalismus bezeichnet. Ziel des QE ist es, den Preis für handelbare Wertpapiere über den Marktpreis hinaus zu erhöhen. Es handelt sich also bei QE nicht um Zinspolitik, sondern um die Subventionierung von Finanzunternehmen zum Zweck der Stabilisierung des gegenwärtigen Finanzsystems.

Diese Subventionierung reduziert natürlich den impliziten Zins des angekauften Wertpapiers.

08.09.2021 13:39:35 [Spiegel]
CDU-Wirtschaftsrat fordert Verbot von Klimaschutzklagen gegen Konzerne

Die Deutsche Umwelthilfe und Greenpeace kündigten erst vor wenigen Tagen an, Industriekonzerne auf mehr Klimaschutz zu verklagen. Nachdem Mercedes-Benz die damit verbundene Forderung nach einem Verkaufsstopp bereits zurückwies, formiert sich nun auch politisch Widerstand gegen solche Aktionen: Der CDU-Wirtschaftsrat fordert, entsprechende Klimaschutzklagen gegen Großkonzerne gesetzlich verbieten zu lassen.

»Wenn Aktivisten zur eigenen Profilierung Unternehmen öffentlichkeitswirksam mit juristisch fragwürdigen Klagen überziehen, grenzt das an Rufmord«, sagte Wirtschaftsrat-Generalsekretär Wolfgang Steiger der »Augsburger Allgemeinen«.

08.09.2021 17:37:49 [Brave New Europe]
Booms and Bezzles
Major stock markets are hovering near all-time highs and commodity prices (food and materials) are rocketing. At the other end of the scale, short-term interest rates are near or below zero, and even long-term government and corporate bonds are at record prices. All this is driven by huge injections of money created by central banks to buy bonds and allow corporations and investment institutions to borrow at very low ‘margin’ rates to speculate in stocks, bonds, property and crypto-currencies; and also enable so-called ‘private equity’ firms and hedge funds to raise funds to buy up companies to ‘asset-strip’ and then sell on – merger and acquisition deals are at record levels.
08.09.2021 18:48:59 [TAZ]
Olaf Scholz und die Steuermillionen
Mitten im Wahlkampf ist der SPD-Kanzlerkandidat Olaf Scholz mit zwei Untersuchungsausschüssen konfrontiert. Der eine untersucht seine Verantwortung beim Wirecard-Bilanzskandal, der andere seine Rolle beim Steuerdiebstahl der Hamburger Privatbank MM Warburg. Dabei geht es darum, ob Scholz als damaliger Hamburger Bürgermeister Einfluss auf das Finanzamt genommen hat, um die Warburg-Bank zu schonen. Es ging um eine Forderung von 47 Millionen Euro, die das Finanzamt damals verjähren ließ.

Bei dem Geld handelte es sich um Kapitalertragsteuer aus einem sogenannten Cum-Ex-Geschäft.

09.09.2021 07:14:30 [Ökonomenstimme]
Entkopplung von globalen Wertschöpfungsketten
Die Pandemie hat enorme Verwerfungen in globalen Wertschöpfungsketten ausgelöst, weltweit wird denn auch das Ziel einer geringeren Exponiertheit gegenüber ausländischen Schocks diskutiert. Dieser Beitrag quantifiziert Wohlfahrtskosten und potenzielle Vorteile einer Entkopplung von globalen Wertschöpfungsketten. Das Fazit: Sie zahlt sich nicht aus.

Die Covid-19 Pandemie verursacht vielfach gravierende Ausfälle von Zwischenprodukten in globalen Wertschöpfungsketten. Dieser Schock trifft die Weltwirtschaft in einer Phase des stagnierenden Wachstums im internationalen Handel und der globalen Wertschöpfungsketten.

09.09.2021 09:37:08 [Junge Welt]
Deals mit Terroristen: Gute Geschäfte im Kalifat
Neue und möglicherweise entscheidende Niederlage für den französischen Zementgiganten Lafarge: Das Oberste Revisionsgericht Frankreichs entschied am Dienstag, dass der Konzern wegen im Norden Syriens geleisteter »Beihilfe zu Verbrechen gegen die Menschlichkeit« angeklagt werden darf. Die Richter kassierten damit das Urteil eines Pariser Berufungsgerichts, das im November 2019 entschieden hatte, Ermittlungen zu diesem Punkt nicht zuzulassen. Auf Antrag der NGO Sherpa und des Europäischen Zentrums für Verfassungs- und Menschenrechte (ECCHR) untersucht die französische Justiz seit 2017, ob der weltweit größte Zementproduzent von 2014 an die Terrororganisation »Islamischer Staat« (IS) mit »Schutzgeld« in Millionenhöhe schmierte, um mitten im Krieg den Betrieb seiner besonders gewinnträchtigen Fabrik im syrischen Dschalabija aufrecht zu erhalten.
09.09.2021 11:38:32 [Tichys Einblick]
EZB-Rat erwägt bloß Verlangsamung der Anleihekäufe
Seit Verhängung der Lockdowns hat die EZB ihre konsolidierte Bilanz rasant ausgeweitet. Die Bilanzsumme verdoppelte sich nahezu auf über 8,2 Billionen Euro. Das treibt nicht bloß die Preise von Vermögensgütern wie Aktien und Immobilien nach oben, sondern auch zunehmend die Konsumentenpreise. Im Euroraum lag der Harmonisierte Verbraucherpreisindex im August bei 3 Prozent – in Deutschland verteuerten sich Alltagsgüter innerhalb eines Jahres um 3,9 Prozent.

Die Öffentlichkeit schaut deswegen gebannt auf die Sitzung des EZB-Rates, der am Donnerstag (13.45 Uhr) den weiteren geldpolitischen Kurs und eine Inflationsprognose verkündet.

09.09.2021 16:48:19 [Start Trading]
DAX: Die EZB und ihre Geldpolitik
Die heutige EZB-Ratssitzung ist vorüber. Der DAX zeigte sich im Vorfeld dieses Ereignisses volatil. Anleger wissen nicht so recht, was sie gerade machen sollen. Sollen sie lieber Geld vom Tisch nehmen, indem sie Aktien verkaufen oder doch lieber auf die Europäische Zentralbank hoffen? Diese hat in der Vergangenheit die Finanzmärkte geschont. Doch nun haben sich die Voraussetzungen verändert. Ob die EZB ihre Geldpolitik jetzt ändern wird? Zentralbanken müssen Geldpolitik machen. Das ist ihre Kernaufgabe. Allen voran sollen sie die Geldwertstabilität sicherstellen. Man muss für einen Euro über eine lange Zeit dasselbe erwerben können, ist die Überlegung, die dahinter steht.
09.09.2021 17:01:04 [SoZ - Sozialistische Zeitung]
Alles wird gut!?
Wenn man den Konjunkturforschern Glauben schenken darf, befindet sich die Wirtschaft auf dem Weg der Erholung. Hohe Wachstumsraten in diesem Jahr sollen Produktion und Beschäftigung im nächsten Jahr wieder auf Vorkrisenniveau bringen. Nach Überwindung der Corona-Rezession erwarten sie ein etwas langsameres, aber stetiges Wachstum. Gefahren drohen aus ihrer Sicht weniger von erneut steigenden Corona-Infektionen, einem Einbruch der Investitionen und des Konsums oder vom Klimawandel. Wenn etwas den Aufschwung bedrohen könne, dann Angebotsengpässe, Inflation und dadurch angestoßene Lohnsteigerungen.
10.09.2021 13:20:11 [Ökonomenstimme]
Determinanten der Inflation – Vor und nach der globalen Finanzkrise
Wie kommt Inflation zustande? Trotz einer umfangreichen Literatur zu diesem Thema gibt es eine Reihe offener Fragen (siehe Ehrmann et al., 2020). Keinem einzelnen Ansatz ist es gelungen, den Inflationsverlauf befriedigend zu erklären. Eine Vielzahl möglicher Determinanten werden genannt. Die einschlägige Literatur hebt weitgehend ökonomische, institutionelle, technologische und politische Faktoren hervor, die wir in acht ökonomischen Theorien zusammenfassen: (1) natürliche Ressourcen, (2) Demografie, (3) Globalisierung und Technologie, (4) Geld, Kredit und Konjunktur, (5) geldpolitische Strategien, (6) politisch-institutionelle Merkmale, (7) Staatsfinanzen und (8) die vergangene Inflation.
10.09.2021 13:32:01 [Junge Welt]
Finanzmärkte: Wall Street in China
Blackrock macht gute Geschäfte in China. Der größte Vermögensverwalter der Welt hat für seinen ersten Investmentfonds in der Volksrepublik rund eine Milliarde US-Dollar eingesammelt. Der Finanzriese hatte im Juni als erster globaler Konzern die Genehmigung für ein hundertprozentiges chinesisches Investmentfondsgeschäft erhalten. Und das Geld fließt in Strömen. Am Dienstag teilte Blackrock mit, eine Woche früher als erwartet die Mittelbeschaffung abgeschlossen und mehr als 110.000 Investoren gewonnen zu haben.

Hart getroffen hat die Nachricht Börsenguru George Soros. Er hatte tags zuvor in einem Gastbeitrag für das "Wall Street Journal" getönt, Blackrocks Engagement in China sei ein »tragischer Fehler«.

10.09.2021 18:46:23 [Neues Deutschland]
Netze im Finanzstrom
Mit den Besatzungstruppen ist auch das Geld abgezogen: Die USA haben der neuen Regierung Afghanistans den Geldhahn zugedreht. Durch die finanziellen Sanktionen steht das Land nun vor einer tiefen Wirtschaftskrise. »Die Taliban sind die US-Soldaten los, aber nicht den Dollar«, kommentiert die Finanzagentur Bloomberg. Afghanistan ist das jüngste Beispiel dafür, wie Washington die Macht seiner Währung nutzt – eine Strategie, die es im »Krieg gegen den Terror« perfektioniert hat. Mit dem Verbot, sich das US-Geld zu verschaffen, haben die Vereinigten Staaten eine mächtige Waffe gegen Regierungen in der Hand.
10.09.2021 19:00:57 [Brave New Europe]
Circular Economy Subverted?
You know that an environmental concept has reached the mainstream when the Scottish Tories are trying to outflank the Scottish Government on it (even if the Scottish Government are making that rather easy). That’s where we are with the ‘circular economy’.

But it also means that we should start to be vigilant because it is also a sign there is a serious risk of subversion. Every time a major reforming concept has got into mainstream debate in recent times it has been captured, distorted and emasculated.

We have seen everything from ‘wellbeing economics’ to ‘green hydrogen’ subtly transformed from being radical, transformative ideas to being ‘business as usual with some presentational trickery’.

11.09.2021 14:15:31 [Amerika 21]
Der Kampf der USA gegen die chinesische 5G-Technologie in Lateinamerika
Der Ausbau der 5G-Technologie hat im Krieg zwischen USA und China um die technologische Vormacht einen Wendepunkt bedeutet. Unter der Regierung von Donald Trump wurde das Unternehmen Huawei, führende Kraft bei der Entwicklung ebendieser Technologie, auf die "Entity List" 1 gesetzt, weil die USA dem Unternehmen vorwerfen, mit der chinesischen Regierung bei Operationen der Informatikspionage zu kollaborieren. Auch wenn Biden sich in vielen Punkten von der Außenpolitik seines Vorgängers unterscheidet, behält er dessen Haltung gegenüber China bei, dem es die Stirn zu bieten gelte. Beleg dafür sind wirtschaftliche Einschränkungen, die gegen ZTE verhängt wurden, ein weiteres wichtiges chinesisches Unternehmen.
11.09.2021 14:34:39 [Brave New Europe]
Believe me, it will be enough
When debt grows faster than capitalism, the governance of capitalist political economies becomes a Ponzi-like confidence game. It’s summer, Brussels pretends to be on holiday, but no one believes it: the clouds are gathering, no magic solution is in sight, everyone’s nerves are on edge. Forests are burning, it’s raining, rivers are flooding: the “climate crisis” is hitting home in an increasingly undeniable way. Not a single euro of the 750 billion euro Coronavirus “Recovery” Fund has been spent yet, just as the “fourth wave” is beginning to gather momentum. Time for an aggressive additional fiscal stimulus package, but how to pay for it?
11.09.2021 18:39:07 [Deutschlandfunk]
Bitcoin offizielle Währung in El Salvador
Es ist schon ironisch. Der Bitcoin war eigentlich mal eine Anti-Währung. Kein Staat sollte Zugriff darauf haben, keine Zentralbank ihn in die Finger bekommen. Jetzt wird er also Staatswährung.

Das ist nicht gut. Auch wenn El Salvador nur etwa so groß ist wie Hessen und in einem Jahr so viel erwirtschaftet wie die USA an einem Vormittag, der Bitcoin als gesetzliches Zahlungsmittel kann großen Schaden anrichten. Die geläufigen Argumente greifen hier alle: Der Bitcoin schadet dem Klima. Außerdem ist der Bitcoin eine unsichere Währung, weil er nicht von einer Zentralbank abgesichert ist.

11.09.2021 18:47:48 [Tichys Einblick]
Olaf Scholz fummelt an der Schuldenbremse
Ausgabebeschränkungen sind für viele Politiker ein Horror, zumal in Wahlkampfzeiten, in denen sie gern milliardenschwere Versprechungen ins politische Schaufenster stellen: ob für Investitionen, für soziale Leistungen oder Subventionen für wichtige Wählergruppen. Deshalb lässt der SPD-Kanzlerkandidat und amtierende Bundesfinanzminister derzeit in seinem Haus ausloten, wie sich die im Grundgesetz verankerte Kreditaufnahmebeschänkung trickreich umgehen lässt. Aus heutiger Sicht grenzt es fast an ein Wunder, dass es eine solche Schuldenbremse vor 12 Jahren überhaupt ins Grundgesetz geschafft hat.
12.09.2021 09:48:27 [Amerika 21]
Kongress in Kolumbien winkt umstrittene Steuerreform durch
Der kolumbianische Kongress hat in dieser Woche dem neuesten Projekt einer Steuerreform zugestimmt. Nach dem Einigungsverfahren wurden die Anpassungen vom Senat und dem Repräsentantenhaus gutgeheißen. Als nächster Schritt folgt nun die Unterzeichnung durch Präsident Iván Duque. Eine im April geplante Steuerreform und deren Ablehnung durch die Bevölkerung war Auslöser der Massenproteste der letzten Monate.

Finanzminister José Manuel Restrepo setzt beim nun erfolgten weiteren Reformversuch vor allem auf die Erhöhung der Einkommenssteuer bei juristischen Personen.

12.09.2021 12:07:24 [Brave New Europe]
China and Common Prosperity
Back in May the Chinese government set up a special zone to implement ‘common prosperity’ in Zhejiang province, which also happens to be the location of the headquarters of several prominent internet corporations– Alibaba among them. And last month, China’s President Xi Jinping announced plans to spread “common prosperity”, heralding a tough crackdown on wealthy elites – including China’s burgeoning group of technology billionaires. At its August meeting, the Central Finance and Economics Committee, chaired by Xi, confirmed that “Common Prosperity” was “an essential requirement of socialism” and should go together with high quality growth.
12.09.2021 13:41:30 [Start Trading]
DAX-Ausblick: Ist Evergrande die neue Lehman?
Die Börse wartet auf schlechte Nachrichten. Anleger suchen einen Grund, der ihnen einen Aktienverkauf rechtfertigt. Im Grunde ist vielen Marktteilnehmern nämlich klar, dass die Kurse hoch sind. Die aktuellen Bewertungen sind nur aus der Not heraus entstanden. Es gab keine Alternative zu Aktien. Doch nun trübt sich die Stimmung ein. In China wankt der riesige Konzern Evergrande, der in die Pleite zu rutschen droht. Noch wollen die Anleger das Unmögliche nicht wahrhaben. Zum Ausbruch der Finanzkrise wankte die US-Bank Lehman Brothers, weil sie sich mit riskanten Wertpapieren verspekuliert hatte. Ohne Geld in den Kassen konnte sie ihre Verbindlichkeiten nicht bezahlen.
12.09.2021 13:52:38 [Junge Welt]
Geschäfte mit der Ukraine: Politische Begleitung
Die Firma Varex Gesellschaft für Wirtschaftskooperationen GmbH ist ein existierendes BRD-Unternehmen. Nach Recherchen des Spiegel ist sie vor allem ein Briefkasten in einer Münchener Umlandgemeinde. Aber Varex hat Außenstände aus gelieferten Waren.

Normalerweise geht man als Lieferant vor Gericht, wenn der Kunde nicht zahlt. Auch verjähren Forderungen im Geschäftsverkehr meist schnell. Bei Varex geht es indes um Vorgänge, die inzwischen 27 Jahre zurückliegen. Die letzte gerichtliche Auseinandersetzung in der Sache fand 2003 statt – ohne Ergebnis für das deutsche Unternehmen.

12.09.2021 17:34:12 [Gegenblende]
Covid-19 lässt konservative Ökonomen scheitern
Ein jüngst im Wall Street Journal erschienener Kommentar offenbart das schwarze Loch, in das die konservative Wirtschaftstheorie seit ihrer Blütezeit in den 1980er-Jahren gefallen ist. Der Text stammt von den Ökonomen Casey B. Mulligan und Tomas J. Philipson von der University of Chicago, die beide in der Regierung unter Donald Trump tätig waren. Sie nutzen die Covid-19-Pandemie, um dafür zu plädieren, sich von einer gängigen Auffassung in der Ökonomie zu verabschieden, der zufolge "der Sinn der staatlichen Politik darin bestehe, das Versagen des Marktes zu korrigieren."
12.09.2021 18:43:16 [Norbert Häring]
EU-Kommission macht bei Vermögensregister einen halben Rückzieher
Während die etablierten Medien lange den Mantel des Schweigens über die Voruntersuchungen der EU-Kommission zur möglichen Einführung eines allgemeinen Vermögensregisters ausgebreitet hatten, sorgte ein einsamer Blogger für Öffentlichkeit. Das hat offenbar gefruchtet. Wie die "Welt am Sonntag" schreibt, macht die EU-Kommission angesichts der allgemeinen Empörung nun einen Rückzieher. Dank eines Leserhinweises hatte ich am 2. August als Erster und bis 25. August so ziemlich als Einziger darüber berichtet, dass die EU-Kommission am 16. Juli eine „Machbarkeitsstudie für ein Europäisches Vermögensregister in Hinblick auf die Bekämpfung von Geldwäsche und Steuerhinterziehung“ ausgeschrieben hatte.
12.09.2021 18:52:59 [Spiegel]
Tesla kann mit über einer Milliarde Euro Förderung rechnen

Der US-Elektroautobauer Tesla kann einem Medienbericht zufolge voraussichtlich mit staatlichen Fördermitteln von rund 1,14 Milliarden Euro aus einem europäischen Batteriezellenprogramm rechnen. Die Förderung durch das Bundeswirtschaftsministerium sei reif für die Bewilligung, berichtet der »Tagesspiegel«.

Das Bundesministerium und das Brandenburger Wirtschaftsministerium äußerten sich zu dem Bericht nicht. Tesla will in Grünheide bei Berlin nicht nur die erste Elektroautofabrik in Europa bauen, sondern dort auch in großem Umfang Batteriezellen produzieren.

13.09.2021 06:59:06 [Bargeldverbot]
EU will europaweites Bargeldverbot ab 10.000 Euro
Keiner will das Bargeld abschaffen! Bargeldabschaffung ist Verschwörungstheorie. Ein Bargeldverbot will keiner und wird auch nicht kommen. Diese oder ähnliche Aussagen werden uns seit Jahren mantramäßig eingetrichtert. Aber wie ist hierzu die Realität? Wussten Sie, dass eine Bargeldobergrenze bereits einem Bargeldverbot gleichkommt? Ja, Sie haben richtig gelesen. Bei einer Bargeldobergrenze von z.B. 10.000,- € ist es gesetzlich verboten, Waren, Dienstleistungen und Güter ab diesem Betrag bar zu bezahlen. Der Begriff Bargeldobergrenze verschleiert nämlich die wahre Bedeutung des Wortes.
13.09.2021 07:26:06 [Brave New Europe]
Critics of Modern Monetary Theory have to get facts right
Once again we can see how MMT is being defamed with no comprehension of what it is about. The old maxim that when in a hole a person should stop digging clearly passed these authors by. There claims are, to be polite, wrong, but are typical of many made by opponents of MMT.

First of all, MMT need have no policy prescription attached to it. What it describes is the way that money operates in a fiat money economy. That is it.

What it most definitely adds is that there is a limit to the extent to which money may be created.

13.09.2021 09:33:23 [Tichys Einblick]
Der Marktausblick: 9/11, Voodoo-Economics, ESG-Klimbim
Der DAX hat nach dem Absturz rund 85 Prozent zugelegt, der breite US-Index S & P 500 samt Dividenden über 90 Prozent, beim Nasdaq 100 waren es sogar gut 115 Prozent. Zweifelsohne war die Rally nach dem Einbruch im Zuge des ersten Lockdowns trotz zwischenzeitlicher Korrekturphasen wie im November vor der US-Wahl eine für Anleger sehr lohnende Zeit. In diesen Tagen drängt sich ein weiterer Rückblick auf: Die aufquellenden Feuerbälle, als sich am 11. September 2001 die beiden von Al-Quaida-Terroristen gekaperten Flugzeuge in die Zwillingstürme des World Trade Centre in New York bohrten, die Aschewolke über den Häuserschluchten von Manhattan, fliehende, verzweifelte Menschen, verstörte Feuerwehrleute – der Terror sandte weltweit Schockwellen in die Finanzwelt aus.
13.09.2021 13:46:46 [Infosperber]
Freihandelsabkommen: Im Mercosur wächst die Skepsis
Im Osten des Atlantiks, auf der Nordhalbkugel, liegen die EFTA-Mitgliedländer Schweiz, Island, Norwegen und Liechtenstein. Im Westen, auf der Südhalbkugel, liegt der Mercosur mit Argentinien, Brasilien, Uruguay und Paraguay. Die entfernten Regionen haben 2019 ein Freihandels-Abkommen geschlossen. Es ist fertig verhandelt, aber noch nicht ratifiziert. Bei Abschluss bezeichnete der heutige Bundespräsident Guy Parmelin das Mercosur-Freihandelsabkommen als Meilenstein und einmalige Chance für Schweizer Exporteure. Denn diese benötigten einen verlässlichen Rahmen, um auf den turbulenten Weltmärkten zu bestehen.
13.09.2021 15:32:20 [Frankfurter Allgemeine Zeitung]
Wegen Negativzinsen: Bund verdient Milliarden mit seinen Schulden
Der Bund streicht dank Negativzinsen eine Milliardensumme beim Schuldenmachen ein. Bei der Emission von Bundeswertpapieren zur Finanzierung des Haushalts einschließlich Sondervermögen wurden von Januar bis August „Zahlungen in Höhe von rund 4,251 Milliarden Euro vereinnahmt“. Das geht aus einem der Nachrichtenagentur Reuters am Montag vorliegenden Schreiben von Finanzstaatssekretärin Sarah Ryglewski auf eine Anfrage des Bundestagsabgeordneten Fabio De Masi von der Linkspartei hervor.
13.09.2021 17:11:58 [Amerika 21]
Einigung zwischen Uruguay und China führt zu Spannungen im Mercosur
Die erzielte Übereinkunft von Uruguay über ein Handelsabkommen mit China hat bei den übrigen Mitgliedsstaaten des regionalen Wirtschaftsbündnisses Mercosur zu Unruhe geführt. Die Regierung des uruguayischen Präsidenten Luis Lacalle Pou gab außerdem bekannt, auch mit anderen Staaten bilaterale Verhandlungen führen zu wollen.

Uruguay hatte bereits im April angekündigt, vermehrt eigene Wege beim Abschluss von Freihandelsabkommen gehen zu wollen. Nun wiederholte Lacalle Pou, dass man sich zwar weiterhin als Mitglied des Mercosur sehe, jedoch auch die "historische Verantwortung" habe, die "Grenzen für den Weltmarkt zu öffnen".

13.09.2021 18:46:49 [Junge Welt]
EU-Stablilitätspakt: Untaugliche Regeln
Schon in der Finanz-, Wirtschafts- und Euro-Krise ab 2008 war deutlich geworden, dass die Schuldenregeln des EU-Stabilitätspakts untauglich und realitätsfern sind. Eine Schuldenquote unterhalb der vertraglich festgeschriebenen 60-Prozent-Grenze war schon damals eher die Ausnahme als die Regel. Bei den Mitgliedsländern der Währungsunion war die Quote durchschnittlich von 65 Prozent 2008 auf 92,8 Prozent 2014 gestiegen. Trotzdem hatte man mit dem Fiskalpakt 2012 insbesondere die Vorschriften zur jährlichen Neuverschuldung nochmals gestrafft.

Der kleine Aufschwung nach der Euro-Krise entspannte die Lage ein wenig. Dann kam Corona.

13.09.2021 18:50:14 [Telepolis]
Zehn Jahre Industrie 4.0: Null Produktivitätsfortschritt
Die Digitalisierung ist seit Jahren ein Hype in Politik und Wirtschaft. Ohne die Transformation der physischen Welt bleibt Industrie 4.0 aber nur eine Vision. Vor ziemlich genau zehn Jahren, kurz vor der Hannover-Messe 2011, prognostizierten Vertreter der Initiative "Industrie 4.0" eine Transformation der industriellen Produktion, die in eine "vom Internet getriebene 4. industrielle Revolution" führen werde. Deutschland, so vermuteten damals Henning Kagermann, Dieter Lukas und Wolfgang Walser, drei Vertreter dieser Vision aus Wirtschaft, Politik und Wissenschaft, könne wegen seines "hochinnovativen produzierenden Gewerbes" eine führende Rolle einnehmen.
14.09.2021 06:44:14 [Wirtschaftliche Freiheit]
Wirtschaftspolitik nach der Corona-Krise
Plötzliche große Krisen wie die Corona-Pandemie sind die Stunde der Exekutive. Auch wenn die Möglichkeit einer globalen Pandemie von Epidemiologen jahrelang so präzise vorhergesagt und in ihrem erwarteten Ablauf beschrieben worden ist, dass darüber ganze Hollywood-Filme mit frappierender Ähnlichkeit zum Geschehen seit Anfang 2020 gedreht werden konnten, waren die westlichen Industrienationen von der Corona-Pandemie so überrascht, dass Ökonomen sie als „exogenen Schock“ für Gesellschaft, Staat und Wirtschaft charakterisieren.
14.09.2021 11:16:19 [Tichys Einblick]
RWI-Ökonomen erwarten hohe Einbußen durch Lockdown
Nur Ungeimpfte auszuschließen, ist volkswirtschaftlich weniger schädlich als ein Lockdown für alle. Das RWI liefert mit einer Studie neuen Anlass für Forderungen nach Ungleichbehandlung. Die zentrale Erkenntnis aus der Studie des Leibniz-Instituts für Wirtschaftsforschung (RWI) ist eigentlich banal: Ein Lockdown für alle hätte sehr viel höhere volkswirtschaftliche Einbußen zur Folge aus Ausschlussmaßnahmen nur für Ungeimpfte. Auch den Faktor Vier, den die RWI-Ökonomen nennen, hätte wohl jeder halbwegs über ökonomische und mathematische Allgemeinbildung verfügender Bürger wohl schätzen können – wenn man davon ausgeht, dass bald drei von vier Menschen in Deutschland geimpft sein werden.
14.09.2021 11:34:31 [Brave New Europe]
The Vocabulary of Neoliberal Diplomacy in Today’s New Cold War
George Soros has thrown a public hissy fit over the fact that he can’t make the kind of easy money off China that he was able to make when the Soviet Union was carved up and privatized. On September 7, 2021, in his second mainstream editorial in a week, George Soros expressed his horror at the recommendation by Black Rock, the world’s largest asset manager, that financial managers should triple their investment in China. Claiming that such investment would imperil U.S. national security by helping China, Mr. Soros stepped up his advocacy of U.S. financial and trade sanctions.
14.09.2021 15:00:19 [Brave New Europe]
Why the Rich Get Richer and Interest Rates Go Down
In the waning days of August, in a world beset by the unending COVID19 public health crisis, by increasingly frequent extreme climate events, and by the terrible news from Afghanistan, the world’s central bankers, the rich, and the influential gathered (online) for the Federal Reserve Bank of Kansas City’s annual Jackson Hole symposium. The title of this year’s Economic Policy Symposium was “Macroeconomic Policy in an Uneven Economy.” Few observers were paying attention and most had low expectations, knowing that central bankers are caught in a catch-22.
15.09.2021 09:53:01 [Tichys Einblick]
Nach 120 Jahren IAA: Der Mythos Auto ist am Ende
Von den Grünen ist aus den 80er Flegeljahren, als Joschka Fischer noch Steine auf Polizisten geworfen hat, bevor er in Hessen Minister wurde, der Spruch bekannt: „Wir wollen keine Autos mehr, wir fahren per Anhalter.“

Die Zeiten sind zurück. Die ökologische Verdammnis des Autos als Umweltschädling ist inzwischen in der Mitte der Gesellschaft angekommen. Und wie! Die vor wenigen Tagen zu Ende gegangene Internationale Automobilausstellung in München (IAA) ist der beste Beweis dafür. Autogegner und Klimaaktivisten erregten mehr Aufmerksamkeit als alle Exponate und Messe-Veranstaltungen zusammen.

15.09.2021 11:48:04 [Anderwelt Online]
Im Westen dominieren nur noch Monopole – zum Nachteil der Bürger
Wettbewerb und freie Märkte sind angeblich die Basis für den westlichen Kapitalismus und das demokratische System. Durch die Entwicklung zu immer größeren Einheiten sind aber Monopole entstanden, sowohl wirtschaftlich als auch politisch. Deswegen gibt es kaum noch echten Wettbewerb, schon gar nicht im politischen Bereich.

Seit etlichen Jahren haben Internetriesen wie Amazon & Co. die Wettbewerbsprinzipien auf den Kopf gestellt. Die großen Handelskonzerne haben Käuferkartelle gebildet, die darüber bestimmen können, ob und wie ein Produzent überleben darf. Sie bestimmen über ihren Einkaufspreis und somit darüber, welche Löhne die Produzenten ihren Angestellten bezahlen können.

15.09.2021 13:58:03 [German Foreign Policy]
Die „Geoökonomie“ der Exportwalze
Das jüngste Exportwachstum der deutschen Industrie löst in Medien und Wirtschaftsverbänden ein geteiltes Echo aus. Einerseits sind die Ausfuhren aus der Bundesrepublik im Juli erneut gestiegen und liegen jetzt um 1,6 Prozent überdem Niveau vom Februar 2020, dem Monat vor dem ersten großen pandemiebedingten Einbruch. Andererseits schwächt sich das Exportwachstum bereits wieder ab; zudem beruht der jüngste Anstieg nur auf inflationsbedingten Preissteigerungen, während die ausgeführte Warenmenge schrumpft.
15.09.2021 15:31:35 [TAZ]
Chinesischer Immobilienriese am Ende
Nachdem am Montag rund hundert erboste Kleinanleger die Lobby der Hauptzentrale von Evergrande stürmten und lautstark ihr Geld zurückforderten, installierte das Unternehmen in der südchinesischen Metropole Shenzhen etliche Absperrgitter und Sicherheitskräfte vor dem Haupteingang. Weitere Tumulte möchte der angeschlagene Konzern unter allen Umständen vermeiden.

Spätestens seit vergangenem Mittwoch steht Evergrande, ein schon seit Längerem kriselnder Immobilienriese, in existenzieller Notlage. Die Ratingagentur Fitch setzte die Bonitätsbewertung nämlich auf ein katastrophales „CC“.

15.09.2021 15:49:10 [Telepolis]
Warum Friedrich Merz politisch verhindert werden muss
Bei einer Regierungsbeteiligung der Christdemokraten könnte der CDU-Politiker Finanz- oder Wirtschaftsminister werden. Doch Merz kommt vom Investmentgiganten BlackRock. Lobbyismuskritiker warnen. Ende August verkündete CDU-Spitzenkandidat Armin Laschet, Friedrich Merz werde das "wirtschafts-und finanzpolitische Gesicht" seines Wahlkampfs. Sollte die CDU also Teil der nächsten Regierung werden, sieht es danach aus, dass Merz Finanz- oder Wirtschaftsminister wird. Damit droht ein billionenschwerer Interessenkonflikt, denn Merz war von 2016 bis 2020 Aufsichtsratschef beim größten Investmentfonds der Welt.
15.09.2021 17:08:45 [Junge Welt]
Alipay in Schranken gewiesen
Die chinesischen Behörden gehen in ihrer großen Kampagne zur Regulierung der lange Zeit wild wuchernden chinesischen Techkonzerne den nächsten Schritt: Derjenige hinter der Zahlungsapp Alipay soll laut einem Bericht der "Financial Times" vom Montag aufgespalten werden. Alipay gehört zur Ant Group, einem der größten Fintechkonzerne der Welt, den Beijing seit geraumer Zeit immer fester an die Kandare nimmt. Zunächst hatten die Behörden den geplanten Börsengang des Unternehmens in Shanghai und Hongkong Anfang November 2020 kurzfristig abgesagt; dann folgten empfindliche Strafzahlungen und im April die Anordnung, die Ant Group müsse sich aus einem gewöhnlichen Techkonzern in eine Finanzholding umwandeln.
15.09.2021 17:15:58 [Amerika 21]
Neue Milliardenkredite des IWF für Ecuador
Ecuador erhält erneut Kredite vom Internationalen Währungsfonds (IWF). Das gab der Finanzminister des Andenstaates, Simón Cueva, bekannt. Der IWF und die ecuadorianische Regierung einigten sich demnach auf eine Vereinbarung, nach der das Land noch in diesem Jahr 1,5 Milliarden US-Dollar erhalten soll. 800 Millionen davon sollen fließen, sobald der Verwaltungsrat des IWF der Vereinbarung zugestimmt hat. Die Zustimmung gilt als sicher und ist mehr Formsache. 2022 soll dann eine weitere Milliarde hinzukommen.


15.09.2021 19:23:25 [Brave New Europe]
Can globalization be „improved“?
In an excellent just-published book “Six faces of globalization” Anthea Roberts and Nicolas Lamp, produce six plausible narratives of globalization and what, according to each, went wrong or right with globalization. Their approach is to take a given narrative, present all its points as its defenders would, with rather minimal outside (i.e. their own) interventions, and in the second part of the book discuss overlaps and differences between these various narratives.

Here, I will review the six narratives, saying perhaps little about each of them explicitly both because they are all rather well known by the general public and because I hope that my critique of each narrative will indirectly throw sufficient light on narratives’ main points.

16.09.2021 07:13:26 [Wirtschaftliche Freiheit]
Die Rückkehr massiver Staatsausgaben
Die Corona-Pandemie hat nicht nur eine große Gesundheitskrise ausgelöst, sondern auch zu der schwersten globalen Rezession in der Nachkriegszeit geführt. Überall auf der Welt haben die Regierungen ihre Haushaltsschleusen geöffnet, um die Schäden für die Wirtschaft und das Produktionsniveau möglichst gering zu halten. So haben z.B. die USA seit Beginn der Corona-Pandemie konjunkturstützende Maßnahmen in Höhe von USD 5,3 Bill. bzw. 25,5% des BIP ergriffen. Dieser fiskalische Impuls könnte sogar – bei Umsetzung der noch in Planung befindlichen US-Konjunkturprogrammen – auf über USD 9 Bill. oder 40% des BIP 2020 anwachsen.
 Europa, Brüssel, EU, Europäische Union (38)
01.09.2021 09:16:06 [Tichys Einblick]
Die EU will Griechenland zu einem laxeren Grenzschutz veranlassen
Die EU-Kommission hat der griechischen Küstenwache die Überweisung von Geld verweigert, mit dem der Grenzschutz in der Ägäis verbessert werden sollte. Die griechische Regierung soll so offenbar dazu gebracht werden, einen unabhängigen »Mechanismus zur Überwachung der Grundrechte« einzurichten, wie EU-Innenkommissarin Ylva Johansson verriet. Eine Arbeitsgruppe soll diesbezüglich auch schon gegründet sein. Die Kommissarin erwartet »Fortschritte«.

Worauf Johansson letztlich abzielt, zeigt sich heute schon an der Evros-Grenze.

01.09.2021 12:25:58 [Ceiberweiber]
Im Corona-Escape-Room
Man braucht nicht Stunden mit möglichst vielen internationalen Newsquellen zu verbringen, um Corona einzuschätzen. Es genügt ein normaler Vormittag in Wien, um praktisch mit der Nase darauf gestossen zu werden, wie alles zusammenhängt. Denn am 31. August gab es eine Kundgebung für die Aufnahme von Afghanen in Österreich, bei der einige Promis eine dann abgespielte Wortspende abgaben. Darunter befindet sich Heide Schmidt, einst Chefin des Liberalen Forums, das dank Alfred Gusenbauer von 2006 bis 2008 wieder im Parlament war, und jetzt Proponentin des Volksbegehrens gegen Korruption. Obwohl fast niemand kam, waren Medien anwesend und sprachen teilweise sogar von einer Demonstration; die Veranstalter redeten dies auch schön.
01.09.2021 12:44:47 [Telepolis]
Aufregung rund um die Kabinettsumbildung
Am Dienstag erfolgte die seit mehreren Tagen angekündigte Kabinettsreform in Athen. Premierminister Kyriakos Mitsotakis entließ einige seiner bisherigen Mitstreiter aus der Verantwortung, versetzte andere auf neue Posten und sorgte mit zwei Berufungen von Ministern für Aufregung. Der Rechtsanwalt und Parlamentarier Thanos Plevris wird anstelle von Vassilis Kikilias neuer Gesundheitsminister. Plevris ist kein Unbekannter. Wegen der Relativierung der Shoah und der Verteidigung seines Vaters, eines notorischen Holocaustleugners und selbsterklärtem Nazi, haftet ihm schon lange der Ruf eines rechtsextremen Antisemiten an.
01.09.2021 14:22:27 [Jacobin]
Kommunistisch, einfach so
Österreich scheint fest in den Händen der Rechten. Doch in Graz versucht sich eine kleine Partei an radikaler Klassenpolitik aus der Opposition – und erreicht damit den Mainstream. Spätestens bis Februar 2022 hätte die österreichische Stadt Graz neue Kommunalwahlen abhalten müssen. Doch Ende Juni beschloss Bürgermeister Siegfried Nagl von der konservativen Österreichischen Volkspartei (ÖVP), den Wahltermin der zweitgrößten Stadt Österreichs und Hauptstadt des Bundeslands Steiermark bereits für den 26. September festzulegen. Nagls Koalitionspartner, die rechtspopulistische Freiheitliche Partei Österreichs (FPÖ), reagierte auf seine Entscheidung mit Empörung, offensichtlich wurde sie kalt erwischt.
06.09.2021 06:53:49 [Ceiberweiber]
Alfred Gusenbauer, Totengräber der SPÖ
Die SPÖ verlieh Ex-Bundeskanzler Alfred Gusenbauer ihre höchste Ehrung, die Viktor Adler-Plakette. Medien verwendeten eine APA-Meldung oder schrieben etwas Weichgespültes wie die staatliche „Wiener Zeitung„. Die „Viktor Adler-Palette“ von Wolfgang Fellners oe24.at könnte man als subtile Ironie deuten, da Gusenbauer Aufsichtsratsvorsitzender der Strabag ist, doch damit würde man den Boulevard überbewerten. Auf Außenstehende, aber auch Kenner der Sozialdemokratie wirkt die Veranstaltung hingegen wie ein Begräbnis der Partei, nicht gerade eines erster Klasse. Andere klammern sich verzweifelt an das dort verbreitete Narrativ, um auszublenden, wofür Gusenbauer bei vielen steht, die der SPÖ ein anderes Erbe wünschen.
06.09.2021 09:37:33 [NachDenkSeiten]
Duma-Wahlen in Russland
Vom 17. bis zum 19. September wählen die Russen Abgeordnete für das russische Unterhaus, die Duma. 14 Parteien stehen zur Wahl. Darunter sind die vier Parteien, die in der Duma vertreten sind, die Regierungspartei „Einiges Russland“, die Kommunistische Partei der Russischen Föderation (KPRF), die Liberaldemokratische Partei von Wladimir Schirinowski und die sozialistische Partei „Gerechtes Russland – Für die Wahrheit“. Eine spannende Frage wird sein, ob „Einiges Russland“, die seit den Duma-Wahlen 2016 343 der insgesamt 450 Abgeordneten stellt, Verluste einstecken muss. Die von Einiges Russland 2018 beschlossene Heraufsetzung des Renteneintrittsalters hatte in der Bevölkerung für erheblichen Unmut gesorgt.
07.09.2021 15:23:56 [Der Freitag]
Frankreich: Herausforderer Barnier
In Frankreich sind die konservativen Les Républicains (LR) acht Monate vor der Präsidentenwahl dabei, einerseits sich selbst zu zerlegen, andererseits vielleicht einen Coup zu landen. Vor Tagen hat Michel Barnier, Ex-Außenminister, einstiger EU-Kommissar und Brüsseler Verhandlungsführer in Sachen Brexit, seine Kandidatur öffentlich angemeldet. Damit sieht sich die Mitte-rechts-Partei mit einem Überangebot an Bewerbern konfrontiert. Und es ist noch nicht einmal das Verfahren klar, um den Aspiranten zu finden, der im nächsten Frühjahr gegen Emmanuel Macron antritt.
07.09.2021 15:25:32 [TKP]
Dänemark hat mittlerweile weniger Einschränkungen als Schweden
Das Parlament in Kopenhagen hatte kürzlich entschieden, dass ab dem 1. Oktober sämtliche Corona-Maßnahmen beendet werden sollen. Es wird demnach keine Maskenpflicht mehr geben und das Testregime wird abgeschafft. Die Dänen werden dann keine Nachweise mehr bringen müssen, ob sie geimpft oder ungeimpft sind oder ob sie positiv bzw. negativ getestet wurden.

Gemäß dem Parlamentsbeschluss wird Dänemark am 10. September den offiziellen Status von Covid-19 ändern, da heißt, es wird nicht mehr als „kritische Bedrohung für die Gesellschaft“ eingestuft, sondern als Infektionskrankheit, die „gefährlich für die öffentliche Gesundheit“ ist.

07.09.2021 17:18:18 [Telepolis]
Corona in Österreich: Kommt 1-G?
Eine generelle Impfpflicht lehnt der österreichische Kanzler ab, die Maßnahmen, die Sebastian Kurz gestern ankündigte, zielen jedoch darauf ab, die Impfbereitschaft zu erhöhen. Es werde keine Einschränkungen für die geben, die geimpft sind, aber für "die, die noch nicht geimpft sind", sagte er gegenüber dem ORF. Für die Geimpften müsse die Zeit der Lockdowns vorbei sein.

Im Nachbarland ist ein Fünf-Punkte-Programm des Kanzlers, das per Mail an mehrere Redaktionen verschickt wurde, aber von den Landesregierungen noch nicht bestätigt wurde, Gegenstand offener Fragen. Der Neuigkeitswert der fünf Punkte sei begrenzt, urteilt die österreichische Zeitung "Der Standard".

08.09.2021 07:22:19 [Brave New Europe]
Wolfgang Streeck –„Eastern Europe: Playing its own game in EU“
Interview: With the general elections due in Germany next month, observers are talking about the end of the ‘Merkel era’. What has characterised this era and will things change once Angela Merkel is gone?

I think this era was one in which policy became more event-oriented and less strategic than ever before. Her particular skill was to leave aside any long-term ideological and strategic orientations and respond to the challenges of the moment.

If you have a traditional idea of politics, then you call this opportunistic. If you subscribe to a postmodern view of politics, then you call it a particular kind of responsiveness.

08.09.2021 11:20:17 [IPG - Internationale Politik und Gesellschaft]
Tangente statt Dreieck
Europa und die Europäische Union zerfasern gerade in informelle Teilallianzen. Diese werden dabei von sehr unterschiedlichen, bisweilen konträren Ideen angetrieben und sind in unterschiedlichen Geschwindigkeiten unterwegs. Da sind die Sparfüchse der „Frugal Four“, eine nordisch-habsburgische Allianz gegen den „Stabilitäts- und Wachstumspakt“, den sie als Einstieg in die „Schuldenunion“ anklagen. Dann gibt es die „Visegrád Four“, die eine ganz andere, völkisch-nationalistische und christlich-abendländische EU anstreben, sich der Gelder aus Brüssel gerne bedienen und dann mauern gegen – vor allem muslimische – Migranten.
08.09.2021 18:42:23 [Ceiberweiber]
Ibizagate: Whistleblower Hessenthaler?
Julian Hessenthaler steht jetzt vor Gericht, der uns allen als „Ibiza-Detektiv“ ein Begriff ist. Dabei geht es jedoch nicht um das Ibiza-Video, was jene „Zivilgesellschaft“ durcheinanderbringt, die sich jetzt für Hessenthaler ins Zeug wirft. Man würde sich wünschen, dass sie mit der gleichen Leidenschaft wie die Anklageschrift gegen Hessenthaler Recherchen nachgeht, die sich mit Oligarchen, Russenmafia, fremden Geheimdiensten und deren Einfluss auf die Politik befassen. Doch was ist, wenn „die NGOs“, der „Falter“ mit Florian Klenk und „Zackzack“ mit Peter Pilz ein Teil genau davon sind?
09.09.2021 07:04:09 [A&W-Blog]
Was kann der EU-Krisenfonds „RRF“?
Vor einem Jahr einigte sich der Europäische Rat grundsätzlich auf eine neue Recovery and Resilience Facility (RRF) als Hauptelement zur Eindämmung der wirtschaftlichen und sozialen Pandemiefolgen. Aus ihr sollen Investitionen und Vorhaben der Mitgliedstaaten finanziert werden, die Europa gleichzeitig „grüner, digitaler und krisenfester“ machen sollen. Nun wurden die ersten Investitionspläne von der Kommission genehmigt – Zeit für eine Zwischenbilanz.

750 Mrd. Euro – diese Summe sollte nach monatelanger Diskussion unter dem Titel „NextGenerationEU“ für die Krisenbewältigung aufgewendet werden, zusätzlich zum regulären EU-Haushalt von etwa 1.200 Mrd. Euro für die Jahre 2021 bis 2027 und erstmalig durch eigene europäische Anleihen finanziert, ganz im Sinne einer antizyklischen Budgetpolitik.

09.09.2021 07:17:58 [Die Ostschweiz]
Gastronomie nur noch mit Zertifikat
Im Kanton St.Gallen wird geprüft, das Covid-Zertifikat auf Restaurants, Bars und Veranstaltungen auszudehnen. Faktisch dürfte der Entscheid bereits gefallen sein. Grund genug, ihn näher unter die Lupe zu nehmen. Zu was dient die Massnahme – und wem hilft sie wirklich? Regierungen und Behörden sind ziemlich durchschaubar, weil sie immer nach demselben Muster agieren. Es wird angekündigt, etwas stehe in Prüfung, man beobachtet die Reaktionen, danach folgt eine Handlung. Erwartet man nicht gerade einen Volkssturm, setzt man danach um, was man zunächst als Option in den Raum gestellt hat.
09.09.2021 09:18:50 [Krass & Konkret]
Der 2020 in Belarus gescheiterte Coup des ukrainischen Geheimdienstes SBU
Letztes Jahr wollte der Geheimdinest wohl mit Unterstützung der CIA ehemalige Kämpfer der “Volksrepubliken” durch eine geplante Notlandung in die Ukraine verschleppen, um auch Zeugen für den MH17-Prozess zu beschaffen. Das ging spektakulär schief und enthüllt ein wenig den Nebel über Ukraine, Russland und Belarus.

Kurz vor der Präsidentenwahl in Belarus im August 2020 wurden in Belarus 33 angebliche Söldner des privaten und berüchtigten russischen Sicherheitsdienstes Wagner festgenommen. Sie waren am 24. Juli eingereist, hatten sich einige Tage in einem Hotel in Minsk aufgehalten und waren dann in ein Sanatorium im Umland umgezogen.

09.09.2021 09:26:51 [Jacobin]
Wer wählt Marine Le Pen?
Der mögliche Sieg von Marine le Pen und ihrer Partei Rassemblement National (RN) bei den Präsidentschafts- und Parlamentswahlen in Frankreich im Frühjahr nächsten Jahres ist alarmierend. Themen wie innere Sicherheit und Einwanderung, bei denen die Partei große Glaubwürdigkeit genießt, stehen im Zentrum der politischen Debatte und eröffnen ihr immense Wahlchancen.

Als Vertreter dieser Themen hatte der Rassemblement National lange Zeit den Status eines Sammelbeckens der Wut und konnte es sich leisten, andere wirtschafts- und gesellschaftspolitischen Fragen unbeantwortet zu lassen.

09.09.2021 11:40:47 [Süddeutsche Zeitung]
Flüchtlinge in Griechenland: Gefangen im Dauerprovisorium
Ein Jahr nachdem ein Feuer das Flüchtlingslager Moria zerstört hat, leben noch immer etwa 3500 Menschen in einem Übergangscamp auf Lesbos. Die Zustände sollen wohl auch weitere Migranten abschrecken. Es ist still geworden auf Lesbos, ein Jahr nach dem großen Feuer. Nur noch etwa 3500 Menschen halten sich derzeit in dem Flüchtlingslager von Mavrovouni auf, das die Behörden eilig hochgezogen haben, nachdem in der Nacht zum 9. September des vergangenen Jahres die dystopische Landschaft aus Zelten und Containern des alten, erbarmungslos überfüllten Camps von Moria fast restlos in Flammen aufgegangen war.
09.09.2021 18:47:00 [TAZ]
Regierungskrise in Rumänien
Die seit zehn Monaten amtierende rumänische Regierungskoalition steckt in einer schweren Krise. Vier Minister der Allianz aus den Parteien „Union Rettet Rumänien“ (USR) und „Freiheit, Einheit, Solidarität (PLUS) sind geschlossen zurückgetreten und haben die ohnehin instabile Koalition verlassen. Diese besteht momentan nur noch aus der Nationalliberalen Partei (PNL) und dem Demokratischen Verband der Ungarn aus Rumänien (UDMR).

Die Zerwürfnisse zwischen den konservativ-neoliberalen Koalitionspartnern wurden bereits vor einigen Monaten sichtbar, nachdem der inkompetente und von der Coronakrise überforderte Gesundheitsminister Vlad Voiculescu (USR-PLUS) von Premierminister Florin Cîţu (PNL) im April entlassen worden war.

10.09.2021 11:35:01 [Telepolis]
Norwegens Grüne: Kampf gegen das Erdöl im Erdölstaat
Premierministerin Erna Solberg gilt als "norwegische Angela Merkel" - doch auf 16 Jahre Regierungszeit wird sie kaum kommen. Bei den Parlamentswahlen am Montag wird die Mitte-rechts-Regierung unter der 60-jährigen Konservativen wohl schon nach acht Jahren abgelöst.

Kommt es so weit, geltend die Sozialdemokraten als sichere Nachfolger werden die Sozialdemokraten gehandelt. Ihr Erfolgskonzept: Ein Wahlkampf, der die sozialen Unterschiede in den Fokus rückt. "Nun sind gewöhnliche Leute an die Reihe", so der Slogan der Traditionspartei unter Parteichef Jonas Gahr Störe.

10.09.2021 17:17:58 [Junge Welt]
Pariser Anschläge: Das »letzte Wort«
Die Furcht und der Schrecken eines ganzen Volkes sollen aufgearbeitet werden: Seit Mittwoch stehen die mutmaßlichen Attentäter vom 13. November 2015 in Paris vor Gericht. Eine Gerichtsverhandlung hat begonnen, die mindestens neun Monate dauern wird. Ein Prozess ohnegleichen – mit 330 Rechtsanwälten, 1.800 Nebenklägern, 141 akkredierten Medien, 542 Klageschriften –, der zur Traumabewältigung der Nation beitragen soll. Zeitungskommentatoren und Politiker betonten zuletzt, es gehe darum, den Attentätern zu zeigen, dass nicht sie und ihre Waffen, sondern die Vertreter der französischen Justiz das »letzte Wort« haben.
10.09.2021 17:20:48 [Telepolis]
Parlamentswahl Russland
Russland wählt ein neues Parlament und wegen der politischen Stimmung genießen Parteien, die neu in die Duma einziehen könnten, große Aufmerksamkeit. Doch nicht alle machen unzweifelhaft ernste Politik und die, die es tun, werden mit teils merkwürdigen Methoden von den Behörden behindert. Noch vor der deutschen Bundestagswahl wird ein anderes landesweites Parlament gewählt - vom 17. bis 19. September bestimmen die Russen ihre neue Staatsduma. Die Vorzeichen von der allgemeinen Stimmungslage im Volk stehen dabei gar nicht so schlecht für frische Kräfte, neu den Einzug in das Parlament zu schaffen.
10.09.2021 18:44:59 [Junge Welt]
Rachejustiz: Konstruiert und unglaubwürdig
Für die einen ist er ein Held, für andere ein Verbrecher: Julian H., mutmaßlicher Drahtzieher des »Ibiza«-Videos, muss sich seit Mittwoch im niederösterreichischen St. Pölten vorm Schöffensenat des Landesgerichts verantworten. Nicht wegen des heimlich aufgenommen Videos, das im Mai 2019 die österreichische Regierung zu Fall gebracht hatte, sondern wegen Drogenhandels und Urkundenfälschung.

Zur Vorgeschichte: Im Juli 2017 gelang es H. und seinen Kollegen, dem nunmehr ehemaligen FPÖ-Chef und Exvizekanzler Heinz-Christian Strache und dessen langjährigem Parteifreund Johann Gudenus auf der spanischen Insel Ibiza eine Falle zu stellen.

11.09.2021 09:46:28 [Tichys Einblick]
„Pandemie der Ungeimpften“: Das nehme ich Ihnen übel, Herr Kurz
Mir ist schon klar, worum es Kanzler Kurz im Kern geht: Um die Vermeidung neuer Lockdowns, die Österreichs Wirtschaft insgesamt, aber vor allem den zentral wichtigen Wirtschaftszweig Tourismus noch weiter schädigen als schon geschehen. Dass sich der Kanzler der in Neue Volkspartei umbenannten ÖVP um deren zentrale Klientel, die Wirtschaft, nicht zuletzt die Gastwirtschaft kümmert, finde ich nicht nur legitim, sondern notwendig und sympathisch.

Aber wie Kurz dabei im Gleichschritt mit seinem in Wahrheit ungeliebten grünen Koalitionspartner über die Freiheit des einzelnen hinweg trampelt, macht mich zornig.

11.09.2021 18:59:57 [RT DE]
Geld für Nawalny-Bewegung?
Gute Idee! – Jürgen Trittin tappt in Telefon-Falle. Obwohl die russischen Prank-Journalisten Wladimir Kusnezow und Alexei Stoljarow – besser bekannt als Wowan und Lexus – ihre wahre Identität oft nur notdürftig verschleiern, gelingt es ihnen immer wieder, westliche Politiker und Personen des öffentlichen Lebens zu veralbern. In der Regel bitten sie ihre "Opfer" um Hintergrundgespräche, um das eine oder andere politische Geheimnis zu lüften. "Entlarvende" Späße werden dann erst am Ende der Gespräche platziert. Nun ist es aber kein Geheimnis, dass Deutschland den Nawalny-Stab in Russland über geheime Kanäle finanziell unterstützt hat.
11.09.2021 19:03:07 [Der Freitag]
Bosnien: Auf immer verflucht
Srebrenica erstickt in internationaler Hilfe und Wohltätigkeit. Die Zahl der Bewohner nimmt währenddessen weiter ab. Ende Juli spazierte ich durch Srebrenica. Eine Woche vor dem Ende seiner zwölfjährigen Amtszeit hatte Valentin Inzko, Hoher Bevollmächtigter der UNO in Bosnien, kraft seiner diktatorischen Vollmachten ein Gesetz erlassen. Danach sollte die Leugnung eines Genozids in Srebrenica mit bis zu fünf Jahren Haft bestraft werden. Die Reaktionen waren erwartbar: Der Eingriff wurde nicht nur von serbischer, sondern auch von kroatischer Seite abgelehnt. Der zuvor politisch schwächelnde Frontmann der Bosnien-Serben, Milorad Dodik, konnte sich profilieren und forderte die Justiz umgehend mit dem Satz heraus: „Es gibt eine Wahrheit – da war kein Genozid.“
12.09.2021 11:49:16 [Junge Welt]
Lockdown im Gespräch
Im Umfeld der britischen Regierung wird offenbar über einen mehrwöchigen, sogenannten Firebreak Lockdown – zu deutsch etwa: Feuerpausen-Lockdown – im Oktober in England nachgedacht. Ziel dieser Maßnahme sei die Vermeidung einer Überlastung des englischen Gesundheitswesens aufgrund weiter hoher Infektionszahlen. Mit diesem Vorschlag zitierte unter anderem das Nachrichtenportal Inews am Montag ein nicht namentlich genanntes Mitglied des regierungsnahen wissenschaftlichen Beratergremiums SAGE.

Käme ein solcher Lockdown, wäre er nur wenige Monate nach der Ausrufung des sogenannten Freiheitstages Mitte Juli eine ernsthafte Niederlage für Premierminister Boris Johnson.

12.09.2021 17:19:56 [RT DE]
Der Kulturkampf kommt...
...und das Überleben der EU wird davon abhängen, wie sie damit umgeht. Als ich noch Abgeordneter im Europäischen Parlament war, war ich überzeugt davon, dass die Einführung des Euro die Europäische Union irgendwann zu Fall bringen würde. Heute bin ich davon überzeugt, dass die Auferlegung liberaler Werte durch den Westen gegenüber den widerstrebenden osteuropäischen Staaten das Ende der EU bedeuten könnte. Die EU-Kommission drohte Polen mit einer Reihe von Geldbußen wegen einer Reihe von mutmaßlichen Vergehen. Zwei der drei Streitpunkte, die tägliche Geldstrafen zur Folge haben könnten, beziehen sich auf juristische Auseinandersetzungen.
12.09.2021 18:35:25 [Der Freitag]
Litauen: Im Herrgottswinkel
Pabradé liegt abseits bekannter Fluchtrouten. Lotst Belarus bald afghanische Migranten hierher? Der Regen prasselt auf die khakifarbenen NATO-Zelte in der litauischen Kleinstadt Pabradé. Der Blick fällt durch Ritzen eines Metallzauns auf die Unterkünfte und die Pfützen dazwischen. Wäsche hängt an Leinen, es scheint niemanden zu stören, dass sie klatschnass wird. Unter den Planen sitzen Menschen im Dunkeln auf Pritschen und starren in den Wolkenbruch. Vielleicht fragen sie sich, was sie hierher, auf ein so trostloses Stück Erde, verschlagen hat. Einige hundert Meter entfernt an einer Marienstatue vorbei geht es zu einer katholischen Kirche und dem Flüchtlingszentrum der Caritas.
13.09.2021 09:24:14 [Neues Deutschland]
Parlamentswahl: Norwegen wird ein bisschen linker
Norwegen wählt am Montag ein neues Parlament. Nach acht Jahren unter der konservativen Ministerpräsidentin Erna Solberg deuten die Umfragen auf einen Regierungswechsel in Oslo hin. Die besten Chancen werden der sozialdemokratischen Arbeiterpartei eingeräumt, die für eine Parlamentsmehrheit jedoch auf mehrere Koalitionspartner angewiesen sein wird. Wird sie stärkste Kraft, könnte ihr Vorsitzender Jonas Gahr Støre zu Solbergs Nachfolger werden - Norwegen würde dann ebenso wie seine nordischen Partnerländer Dänemark, Schweden und Finnland federführend wieder von den Sozialdemokraten regiert.
13.09.2021 11:58:34 [Ceiberweiber]
Zweierlei Geheimnisverrat
Am 11. September 2021 fand eine Hausdurchsuchung beim ehemaligen FPÖ-Abgeordneten Hans-Jörg Jenewein statt, der einen Beamten zum Geheimnisverrat angestiftet haben soll. Dies geschah unmittelbar nachdem ÖVP-Sicherheitssprecher Karl Mahrer gerichtlich untersagt wurde, derlei zu behaupten. Man sollte, wenn es um den Zusammenhang geht, an die BVT-Affäre, aber auch an Wirecard denken. Doch es ist auch von Bedeutung, wo Geheimnisverrat von allen gedeckt wird, welcher der Staatsanwaltschaft schon auffallen hätte müssen, als sie im August 2016 „News“ las.
13.09.2021 12:07:01 [Telepolis]
"Die Unabhängigkeit umsetzen"
"Un-, Un-, Unabhängigkeit", schallte der Schlachtruf am vergangenen Samstag immer wieder durch die Straßen der katalanischen Metropole Barcelona. Seit langem gibt es riesige Demonstrationen in Katalonien am 11. September, an dem die Katalanen ihren Nationalfeiertag (Diada) begehen und für ihre Unabhängigkeit von Spanien eintreten.

Obwohl die Unabhängigkeitsbewegung angesichts der Covid-Pandemie zaghaft mobilisiert hatte, sind wieder Hunderttausende Menschen ihrem Aufruf gefolgt. Nach Angaben der Veranstalter haben etwa 400.000 Menschen die Straßen Barcelonas geflutet, während die Polizei die Beteiligung auf unglaubwürdige 108.000 absenkt.